<?xml version="1.0" encoding="UTF-8"?><!DOCTYPE article  PUBLIC "-//NLM//DTD Journal Publishing DTD v3.0 20080202//EN" "http://dtd.nlm.nih.gov/publishing/3.0/journalpublishing3.dtd"><article xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink" dtd-version="3.0" xml:lang="en" article-type="research article"><front><journal-meta><journal-id journal-id-type="publisher-id">JBM</journal-id><journal-title-group><journal-title>Journal of Biosciences and Medicines</journal-title></journal-title-group><issn pub-type="epub">2327-5081</issn><publisher><publisher-name>Scientific Research Publishing</publisher-name></publisher></journal-meta><article-meta><article-id pub-id-type="doi">10.4236/jbm.2019.77011</article-id><article-id pub-id-type="publisher-id">JBM-93947</article-id><article-categories><subj-group subj-group-type="heading"><subject>Articles</subject></subj-group><subj-group subj-group-type="Discipline-v2"><subject>Biomedical&amp;Life Sciences</subject></subj-group></article-categories><title-group><article-title>
 
 
  The Application of Electrospray Tandem Mass Spectrometry for &lt;i&gt;de novo&lt;/i&gt; Sequencing of Reduced Insulins
 
</article-title></title-group><contrib-group><contrib contrib-type="author" xlink:type="simple"><name name-style="western"><surname>Xichen</surname><given-names>Gao</given-names></name><xref ref-type="aff" rid="aff1"><sub>1</sub></xref><xref ref-type="corresp" rid="cor1"><sup>*</sup></xref></contrib></contrib-group><aff id="aff1"><label>1</label><addr-line>Gan &amp;amp; Lee Pharmaceutical, Ltd., Beijing, China</addr-line></aff><pub-date pub-type="epub"><day>05</day><month>07</month><year>2019</year></pub-date><volume>07</volume><issue>07</issue><fpage>135</fpage><lpage>150</lpage><history><date date-type="received"><day>21,</day>	<month>June</month>	<year>2019</year></date><date date-type="rev-recd"><day>26,</day>	<month>July</month>	<year>2019</year>	</date><date date-type="accepted"><day>29,</day>	<month>July</month>	<year>2019</year></date></history><permissions><copyright-statement>&#169; Copyright  2014 by authors and Scientific Research Publishing Inc. </copyright-statement><copyright-year>2014</copyright-year><license><license-p>This work is licensed under the Creative Commons Attribution International License (CC BY). http://creativecommons.org/licenses/by/4.0/</license-p></license></permissions><abstract><p>
 
 
  Insulin, a blood glucose level mediator, is the mainstream therapeutic choice for diabetes patients. Since patent protection for many originator products is about to expire, manufacturers of follow-on insulin are determined to get their products authorized. According to regulations, a fundamental requirement for biosimilar compounds is that the chemical structure should be the same as that of the originator drug. Hence, the application of qualitative analysis for insulin products is essential during the production and development of biosimilars. In this study, the electrospray tandem MS/MS based 
  de novo sequencing method was developed and validated by analyzing two insulin products with similar primary structures, namely recombinant human insulin and insulin aspart. The results indicated that the complete sequences of both reduced insulins are largely identifiable, although differentiation between leucine and isoleucine is not achieved. More importantly, the observed mass accuracy was substantial. The method can, therefore be applied to quality control and drug development.
 
</p></abstract><kwd-group><kwd>Insulin</kwd><kwd> Tandem Mass Spectrometry</kwd><kwd> Electrospray</kwd><kwd> &lt;i&gt;de novo&lt;/i&gt; Sequencing</kwd></kwd-group></article-meta></front><body><sec id="s1"><title>1. Introduction</title><p>Diabetes is currently an incurable and potentially life-threatening disorder that occurs in patients whose pancreas β cells cannot secrete a sufficient amount of insulin into the blood, resulting in elevated blood glucose levels. In severe cases, the gland could lose its function entirely. High blood sugar levels cause severe impairments in all the body’s organs, particularly the kidneys, the nervous system, and the visual system. Diabetes affected approximately 382 million people globally in 2013, and this figure is expected to reach 592 million by 2035 [<xref ref-type="bibr" rid="scirp.93947-ref1">1</xref>]. Another research report from the International Diabetes Federation (IDF) demonstrates that around 415 million people suffered from diabetes in 2015 and that this number will reach 642 million by 2040, including a considerable number of patients from middle- and low-income countries [<xref ref-type="bibr" rid="scirp.93947-ref2">2</xref>]. Since diabetes patients require continuous treatment, the global cost associated with diabetic treatment reached $673b in 2015, and is expected to exceed $802b by 2040 [<xref ref-type="bibr" rid="scirp.93947-ref2">2</xref>]. As the primary therapeutic solution for both type I and type II diabetes, a growing number of insulin products have been developed since the first patient was successfully treated with animal-origin insulin in 1922 [<xref ref-type="bibr" rid="scirp.93947-ref3">3</xref>]. It is expected that the global insulin market will reach $32 billion in 2019 [<xref ref-type="bibr" rid="scirp.93947-ref4">4</xref>]. The heavy financial burden associated with diabetic treatment has been a common obstacle for many countries, particularly developing countries. The good news is that the patents for a series of insulin products are due to expire shortly, which represents an opportunity to provide patients with access to more affordable follow-on drugs [<xref ref-type="bibr" rid="scirp.93947-ref5">5</xref>].</p><p>However, the manufacture of biomedicines is more complicated than that of chemical drugs. Based on the definition of “biosimilars” given by the European Medicines Agency (EMA), a biosimilar is an exact copy of an approved reference drug, and the consistency in physiochemical characteristics, safety, and clinical efficacy between the biosimilar and the innovator product must be evaluated [<xref ref-type="bibr" rid="scirp.93947-ref6">6</xref>]. Due to the proprietary manufacturing process patented by the innovator, manufacturers of biosimilars must develop independent expression systems. Merely copying the chemical and biological properties of an originator drug does not ensure the new compound’s safety and bio-equivalency [<xref ref-type="bibr" rid="scirp.93947-ref7">7</xref>]. One of the biggest safety concerns is immunogenicity, which can trigger immunological reactions or compromise the drug’s efficacy. Potential immunoreactions include insulin allergies, antibody-mediated insulin resistance, and others [<xref ref-type="bibr" rid="scirp.93947-ref8">8</xref>] [<xref ref-type="bibr" rid="scirp.93947-ref9">9</xref>]. The occurrence of immunoreactions is attributable to many factors, such as the drug’s amino acid sequence, spatial structure, and other characteristics that are influenced by the manufacturing process [<xref ref-type="bibr" rid="scirp.93947-ref5">5</xref>]. Three different manufacturing processes based on recombinant DNA technology have been developed, two of which use E. coli as an expression system, while the third uses yeast cells [<xref ref-type="bibr" rid="scirp.93947-ref10">10</xref>]. The detailed manufacturing process was summarized by [<xref ref-type="bibr" rid="scirp.93947-ref11">11</xref>]. The author stresses that minor changes in environmental and processing conditions could result in altered product structures which could, in turn, result in a latent potential for immunogenicity. For instance, a series of structural changes could occur if production or storage is not performed correctly, including oxidation, deamidation, and polymer formation [<xref ref-type="bibr" rid="scirp.93947-ref12">12</xref>]. Therefore, robust quality control techniques are indispensable [<xref ref-type="bibr" rid="scirp.93947-ref13">13</xref>].</p><p>To guarantee safety and efficacy, a drug’s amino acid sequence must be analyzed using advanced analytical techniques (e.g., peptide mapping, mass spectrometry, and in-situ analysis) to ensure that the amino acid structure is consistent with that of the originator drug within single batches and between batches [<xref ref-type="bibr" rid="scirp.93947-ref14">14</xref>]. As a result of incredible advances in mass spectrometry (MS) technology, MS-based de novo sequencing plays an increasingly crucial role in the identification of proteins. De novo sequencing is emphasized due to its application of soft ionization technology, the broad selection of mass spectrometers that supports it, and the highly automated data manipulation that it offers [<xref ref-type="bibr" rid="scirp.93947-ref15">15</xref>].</p><p>In this study, the amino acid structures of recombinant human insulin and recombinant insulin aspart were determined using the tandem MS/MS ESI-QToF system. Data manipulation was performed using Unify. Furthermore, identification accuracy was conducted via mass error calculation. By doing so, the potential utilization of the method in the quality control of insulin biosimilars and drug development could be evaluated.</p></sec><sec id="s2"><title>2. Materials and Methods</title><sec id="s2_1"><title>2.1. Chemicals and Reagents</title><p>The reference standards of insulin human and insulin aspart were purchased from USP (100 mg for insulin human and 7.62 mg for insulin aspart; MD, USA). Acetonitrile (LC/MS grade) was obtained from Fisher Chemical (Geel, Belgium). Formic acid was HPLC grade and purchased from ROE (DE, USA). Methanol (HPLC grade) was bought from Sigma Aldrich (MO, USA). The HPLC grade isopropanol was got from CNW (Anpel Laboratory Technologies, Shanghai, China). Tris (2-carboxyethyl) phosphine hydrochloride (TCEP; Sigma Aldrich, MO, USA) was used as the reductant in the reduction of disulfide bonds. The deionized water used in the experiment was produced by MilliQ water system (Millipore S.A.S., Molsheim, France).</p></sec><sec id="s2_2"><title>2.2. Sample Preparation</title><p>The insulin stock solutions (0.1 mg/ml) were prepared by dissolving 5 mg human insulin and insulin aspart in 50 ml 0.1% formic acid solution, respectively. The human insulin sample to be reduced was prepared by adding around 28.7 mg TCEP (10 mM) into an empty 15 ml centrifuge tube, followed by transferring 0.5 ml insulin human stock solution to the tube, and then adding 0.1% formic acid solution to 10 ml. subsequently, the solution was mixed thoroughly, until the TCEP was fully dissolved. The preparation of the insulin aspart sample to be tested was same as that of the human insulin. Both insulin samples were incubated at 55˚C in water bath for 60 min to fully cleave the disulfide bonds. After cooling to room temperature, the samples were injected and analyzed directly.</p></sec><sec id="s2_3"><title>2.3. Chromatographic and Mass Spectrometric Settings</title><p>LC-MS/MS analysis was conducted by employing Acquity I Class Plus UPLC (Waters, MA, USA) coupled with Vion IMS QToF (Waters, MA, USA). The samples were kept cooled at 4˚C in the autosampler, and the column oven temperature was 40˚C. A Waters Acquity UPLC protein BEH C4 column (50 &#215; 2.1 mm, 1.7 μm, 300 &#197;) was installed, which was highlighted by the significantly reduced retention of protein in column compared to C18 ligand column. The mobile phase A was 0.1% formic acid in water (v/v), and acetonitrile containing 0.1% formic acid was used as mobile phase B. The flow rate was set at 0.4 ml/min. 10 μl sample was injected for each analysis. The gradient initiated at 80% solvent A, and decreased to 70% within 3 min, followed by a linear gradient from 70% down to 40%. The fraction of solvent A was kept for 0.5 min, and then the column was re-equilibrated at the starting conditions from 7.6 min to 10 min.</p><p>Positive electrospray ionization (ESI) was used to generate the parental ions. The acquisition mode was MS<sup>E</sup>, which was a unique mode provided by Waters. The mass scan ranged from 500 m/z to 2000 m/z. The scan time was 0.2 s, during which the low collision energy of CID was set at 6 eV, and the high collision energy ramp started from 20 eV to 30 eV. The desolvation temperature and source temperature were 400˚C and 100˚C, respectively. The desolvation gas flow rate and cone gas flow rate were 650 L/H and 50 L/H, respectively. The capillary voltage was 3.2 kV. The data acquisition and manipulation were carried out utilizing Unify 1.9.3.</p></sec></sec><sec id="s3"><title>3. Results and Discussion</title><sec id="s3_1"><title>3.1. The Reduction of Disulfide Bonds</title><p>Insulin consists of two peptide chains (namely A-chain and B-chain) connected via two interchain disulfide bonds. An intrachain disulfide bond also bridges the 7<sup>th</sup> cysteine and the 11<sup>th</sup> cysteine within the A-chain. Since disulfide bonds are challenging to break via collision-induced ionization (CID), it is necessary to cleave the bond to obtain detailed debris ions [<xref ref-type="bibr" rid="scirp.93947-ref16">16</xref>]. In this study, recombinant human insulin and insulin aspart was reduced using TCEP and incubation at 55˚C over a period of 60 min. The underlying functional mechanism of TCEP was outlined decades ago [<xref ref-type="bibr" rid="scirp.93947-ref17">17</xref>] [<xref ref-type="bibr" rid="scirp.93947-ref18">18</xref>]. The reduction is characterized by the reversible formation of a thiophosphonium compound, followed by the irreversible generation of thiols and phosphine oxide. The results showed that, under these conditions, both insulins could be nearly fully cleaved. Two isolated peptide chains for each insulin were detected and separated using UPLC. As shown in <xref ref-type="fig" rid="fig1">Figure 1</xref>, human insulin’s A- and B-chains eluted at 3.24 min and 2.59 min, respectively. Interestingly, the retention times of insulin aspart’s free A-chain and B-chain (<xref ref-type="fig" rid="fig2">Figure 2</xref>) were almost identical with that of human insulin since the amino acid sequences of human insulin’s A-chain and insulin aspart are identical, and the B-chain’s primary peptide structures for both human insulin and insulin aspart are very similar.</p><p>The peaks were identified based on the parent ion clusters, and the combined corresponding spectra for human insulin and insulin aspart are shown in Figures 3-6. Generally, intact insulin molecules can be adequately ionized using ESI, and multiple protonated ions (ranging from four-fold to six-fold) are observable [<xref ref-type="bibr" rid="scirp.93947-ref16">16</xref>].</p><p>As depicted in <xref ref-type="fig" rid="fig3">Figure 3</xref>, the double- and triple-charged precursor ion clusters of the A-chain were detectable. However, the coexistence of the quintuple- and sextuple-charged precursor ions of intact human insulin was also observed, suggesting that a certain amount of intact insulin was not reduced using TCEP. On the contrary, human insulin was absent in the B-chain peak, although the triple-, quadruple-, and quintuple-fold protonated precursor ions were identifiable in the B-chain (<xref ref-type="fig" rid="fig4">Figure 4</xref>).</p><p>Regarding insulin aspart, the double- and triple-charged ion clusters of the A-chain and the triple-, quadruple-, and quintuple-charged clusters of the B-chain are shown in <xref ref-type="fig" rid="fig5">Figure 5</xref> and <xref ref-type="fig" rid="fig6">Figure 6</xref>. Simultaneously, intact insulin aspart was not detected within the two peaks.</p><p>Many researchers have reduced insulin’s disulfide bonds via TCEP under various experimental conditions. For instance, Hjorth, Hub&#225;lek et al. investigated high molecular weight proteins in a human insulin product manufactured by Novo Nordisk A/S [<xref ref-type="bibr" rid="scirp.93947-ref12">12</xref>]. The researchers reduced the disulfide bond using 4.8 mM TCEP at 37˚C for 30 min. The sample’s peaks contained partially reduced product, which is consistent with previous research findings (data not displayed). Gray, claiming to have successfully cleaved insulin, performed the reduction at 60˚C for 10 min using 10 mM TCEP [<xref ref-type="bibr" rid="scirp.93947-ref19">19</xref>]. According to research conducted by Thevis, Thomas et al., human insulin could be reduced using 10 mM TCEP at 60˚C for 10 min [<xref ref-type="bibr" rid="scirp.93947-ref20">20</xref>]. However, the results did not indicate whether the disulfide bond was fully cleaved. Although partially reduced product may be present, its effect on the de novo sequencing of free peptide chains can be safely disregarded in this study.</p></sec><sec id="s3_2"><title>3.2. The Primary Structure of Free Insulin Peptide Chains</title><p>In this study, a hybrid quadruple ToF mass spectrometer coupled with CID was employed to evaluate the amino acid sequence of isolated insulin peptide chains. The fragmentation pattern observed in CID is the typical N- and C-terminus fragmentation described by Biemann and Roerpstorff [<xref ref-type="bibr" rid="scirp.93947-ref21">21</xref>]. Therefore, the amino acid structure was determined through the recognition of b- and y-debris ions, based on the secondary mass spectra. The data processing was completed automatically in Unify.</p><sec id="s3_2_1"><title>3.2.1. Recombinant Human Insulin</title><p>To acquire copious fragment ions, a collision-energy ramp (20 eV - 30 eV) was used inside the CID compartment. The spectrum results were especially useful, but interpreting the data was problematic. Unify was used to post-analyze the spectrum results. Through the assignment of y- and b-type ions, the entire sequences of two free peptide chains were pinpointed. The complete sequence exposure of human insulin (A-chain) is indicated in <xref ref-type="fig" rid="fig7">Figure 7</xref>. The pinpointed daughter ions comprised 15 y-ions and 16 b-ions. However, the Gly-Lle/Leu-Val-Glu-Gln sequence was unconfirmable, conceivably due to the collision energy not being sufficiently high to fully cleave the peptide inside the CID chamber.</p><p><xref ref-type="fig" rid="fig8">Figure 8</xref> demonstrates the fragmentation ion spectrum (fluctuating between 1000 m/z and 1085 m/z). Some isotopic envelopes have not yet been established, although virtually all the essential clusters are assignable. Daughter ion clusters were observable at 1016.46 m/z, 1028.42 m/z, 1034.47 m/z, 1046.43 m/z (respectively</p><p>signifying b10<sup>+</sup>-H<sub>2</sub>O, y8<sup>+</sup>-H<sub>2</sub>O, b10<sup>+</sup>, and y8<sup>+</sup>). Conversely, the ion clusters observed at 1057.43 m/z, 1068.40 m/z, 1074.48 m/z, and 1085.39 m/z remain unidentified.</p><p>Likewise, the fragmentation ion mapping for B-chain human insulin indicated that nearly the entire B-chain peptide sequence was pinpointed, although two unassigned gaps were detected between the 3<sup>rd</sup> and 4<sup>th</sup> residues, and the 28<sup>th</sup> and 30<sup>th</sup> residues (<xref ref-type="fig" rid="fig9">Figure 9</xref>).</p><p>As shown in <xref ref-type="fig" rid="fig1">Figure 1</xref>0, both single- and double-charged daughter ions were created. Neutral H<sub>2</sub>O (18 Da) and NH<sub>3</sub> (17 Da) losses from y- and b-daughter ions were identified as satellite ions. Between 590 m/z and 715 m/z, two double-charged b-type ions, two-double charged y-ions, and one single-charged y-ion were observed (determined as b11<sup>2+</sup>, b12<sup>2+</sup>, y11<sup>2+</sup>, y12<sup>2+</sup>, and y5<sup>+</sup>), in addition to the satellite ions. However, for both free peptide chains, some isotopic clusters could not be allocated. For now, the differentiation of leucine and isoleucine is still problematic.</p></sec><sec id="s3_2_2"><title>3.2.2. Recombinant Insulin Aspart</title><p>Insulin aspart is a recombinant human insulin analog, where the proline (in the 28<sup>th</sup> position) in B-chain human insulin is substituted with aspart.</p><p>Unlike the results garnered from A-chain human insulin, the occurrence of y18<sup>+</sup> and y19<sup>+</sup> ions suggests that the 18<sup>th</sup>, 19<sup>th,</sup> and 20<sup>th</sup> amino acid sequences are determinable (<xref ref-type="fig" rid="fig1">Figure 1</xref>1). However, distinguishing between leucine and isoleucine remains challenging. In the range of 1445 m/z - 1535 m/z, all the critical ion clusters were allocated, including y12<sup>+</sup>, b14<sup>+</sup>, and the observed satellite ions (<xref ref-type="fig" rid="fig1">Figure 1</xref>2).</p><p>The fragmentation ion mapping for B-chain recombinant insulin aspart shows two undetermined gaps (i.e., Asn-Gln and Thr-Asp-Lys; <xref ref-type="fig" rid="fig1">Figure 1</xref>3). Thevis, Thomas et al. created b4 and y2 ions through an ESI-CID-Qtrap configuration with a high-collision offset voltage of 70 V [<xref ref-type="bibr" rid="scirp.93947-ref22">22</xref>] , suggesting that high-collision energy was necessary for superior fragmentation behavior in insulin aspart. It is important to note that isoleucine and leucine remain undifferentiated. Thomas, Sch&#228;nzer et al. attempted to pinpoint molecules with matching molecular masses by way of adding another dimension of separation (e.g., using an ion mobility spectrometer) [<xref ref-type="bibr" rid="scirp.93947-ref23">23</xref>]. Using an ion mobility spectrometer, Asbury and Hill Jr. claimed to have obtained a 0.668 resolution between leucine and isoleucine [<xref ref-type="bibr" rid="scirp.93947-ref24">24</xref>]. Therefore, additional research with the tandem MS/MS system is required to differentiate between leucine and isoleucine.</p><p>As shown in <xref ref-type="fig" rid="fig1">Figure 1</xref>4, double- and triple-charged ions were observed in the spectrum. In the range of 895 m/z - 1000 m/z, almost all the important isotopic envelopes were assignable (including b16<sup>2+</sup>, b17<sup>2+</sup>, y15<sup>2+</sup> - y17<sup>2+</sup>, and y24<sup>3+</sup> - y26<sup>3+</sup>). Curiously, satellite ions with neutral NH<sub>3</sub> or H<sub>2</sub>O losses were not detected within this range.</p></sec><sec id="s3_2_3"><title>3.2.3. The Evaluation of Identification Accuracy</title><p>Mass accuracy was assessed via mass error. The measured isotopic mass and the mass error for each free insulin chain are presented in <xref ref-type="table" rid="table1">Table 1</xref>. Note that the</p><table-wrap id="table1" ><label><xref ref-type="table" rid="table1">Table 1</xref></label><caption><title> The observed mass and the mass accuracy for each isolated insulin peptide chain</title></caption><table><tbody><thead><tr><th align="center" valign="middle" >Peptide name</th><th align="center" valign="middle" >Peptide sequence</th><th align="center" valign="middle" >Expected mass (Da)</th><th align="center" valign="middle" >Measured mass [M+H]<sup>+</sup> (Da)</th><th align="center" valign="middle" >Mass error (ppm)</th></tr></thead><tr><td align="center" valign="middle" >Human insulin A chain</td><td align="center" valign="middle" >GIVEQCCTSICSLYQLENYCN</td><td align="center" valign="middle" >2382.0001</td><td align="center" valign="middle" >2383.0117</td><td align="center" valign="middle" >1.8</td></tr><tr><td align="center" valign="middle" >Human insulin B chain</td><td align="center" valign="middle" >FVNQHLCGSHLVEALYLVCGERGFFYTPKT</td><td align="center" valign="middle" >3427.6846</td><td align="center" valign="middle" >3428.7033</td><td align="center" valign="middle" >3.3</td></tr><tr><td align="center" valign="middle" >Insulin aspart A chain</td><td align="center" valign="middle" >GIVEQCCTSICSLYQLENYCN</td><td align="center" valign="middle" >2382.0001</td><td align="center" valign="middle" >2383.0080</td><td align="center" valign="middle" >0.3</td></tr><tr><td align="center" valign="middle" >Insulin aspart B chain</td><td align="center" valign="middle" >FVNQHLCGSHLVEALYLVCGERGFFYTDKT</td><td align="center" valign="middle" >3445.6588</td><td align="center" valign="middle" >3446.6760</td><td align="center" valign="middle" >2.9</td></tr></tbody></table></table-wrap><p>criterion for mass accuracy defined by USP is 500 ppm. The results showed that the mass error for each peptide chain was below both the in-house criterion (i.e., 10 ppm) and USP standard, indicating that the mass accuracy was highly satisfactory.</p></sec></sec></sec><sec id="s4"><title>4. Conclusion</title><p>For this study, recombinant human insulin and insulin aspart were analyzed using the ESI-QToF technique. The results showed that nearly all the necessary fragmentation ion information could be obtained through de novo sequencing. However, discriminating between leucine and isoleucine was challenging using this tandem MS/MS system. Therefore, an additional dimension of separation (e.g., using an ion mobility spectrometer) may be necessary. The observed mass error was also deficient, suggesting that Unify can accurately interpret the sequencing data. Therefore, this method shows great potential for the identification of recombinant human insulin and the analogue products during quality control and drug development.</p></sec><sec id="s5"><title>Conflicts of Interest</title><p>The author declares no conflicts of interest regarding the publication of this paper.</p></sec><sec id="s6"><title>Cite this paper</title><p>Gao, X.C. (2019) The Application of Electrospray Tandem Mass Spectrometry for de novo Sequencing of Reduced Insulins. Journal of Biosciences and Medicines, 7, 135-150. https://doi.org/10.4236/jbm.2019.77011</p></sec></body><back><ref-list><title>References</title><ref id="scirp.93947-ref1"><label>1</label><mixed-citation publication-type="other" xlink:type="simple">Lavalle-Gonz&amp;aacute;lez, F.J. and Khatami, H. (2014) The Biosimilar Insulin Landscape: Current Developments. Postgraduate Medicine, 126, 81-92.https://doi.org/10.3810/pgm.2014.10.2823</mixed-citation></ref><ref id="scirp.93947-ref2"><label>2</label><mixed-citation publication-type="other" xlink:type="simple">Pontes, C.E.C., Gouvea Barroso, W.B. and da N&amp;oacute;brega Rito, P. (2019) Market for Biotechnology Drugs: Market Analysis of Insulin. Journal of Pharmaceutical Health Services Research, 10, 219-226. https://doi.org/10.1111/jphs.12278</mixed-citation></ref><ref id="scirp.93947-ref3"><label>3</label><mixed-citation publication-type="other" xlink:type="simple">Ladisch, M.R. and Kohlmann, K.L. (1992) Recombinant Human Insulin. Biotechnology Progress, 8, 469-478. https://doi.org/10.1021/bp00018a001</mixed-citation></ref><ref id="scirp.93947-ref4"><label>4</label><mixed-citation publication-type="other" xlink:type="simple">Heinemann, L. (2016) Biosimilar Insulin and Costs: What Can We Expect? Journal of Diabetes Science and Technology, 10, 457-462.https://doi.org/10.1177/1932296815605337</mixed-citation></ref><ref id="scirp.93947-ref5"><label>5</label><mixed-citation publication-type="other" xlink:type="simple">White, J. and Goldman, J. (2019) Biosimilar and Follow-on Insulin: The Ins, Outs, and Interchangeability. Journal of Pharmacy Technology, 35, 25-35.https://doi.org/10.1177/8755122518802268</mixed-citation></ref><ref id="scirp.93947-ref6"><label>6</label><mixed-citation publication-type="other" xlink:type="simple">Owens, D.R., Landgraf, W., Schmidt, A., Bretzel, R.G. and Kuhlmann, M.K. (2012) The Emergence of Biosimilar Insulin Preparations—A Cause for Concern? Diabetes Technology &amp; Therapeutics, 14, 989-996. https://doi.org/10.1089/dia.2012.0105</mixed-citation></ref><ref id="scirp.93947-ref7"><label>7</label><mixed-citation publication-type="other" xlink:type="simple">Peters, A.L., Pollom, R.D., Zielonka, J.S., Carey, M.A. and Edelman, S.V. (2015) Biosimilars and New Insulin Versions. Endocrine Practice, 21, 1387-1394. https://doi.org/10.4158/EP14595.RA</mixed-citation></ref><ref id="scirp.93947-ref8"><label>8</label><mixed-citation publication-type="other" xlink:type="simple">Frost, H. (2005) Antibody-Mediated Side Effects of Recombinant Proteins. Toxicology, 209, 155-160. https://doi.org/10.1016/j.tox.2004.12.028</mixed-citation></ref><ref id="scirp.93947-ref9"><label>9</label><mixed-citation publication-type="book" xlink:type="simple">Malucchi, S. and Bertolotto, A. (2008) Clinical Aspects of Immunogenicity to Biopharmaceuticals. In: Weert, M., M&amp;oslash;ller, E.H., et al., Eds., Immunogenicity of Biopharmaceuticals. Biotechnology: Pharmaceutical Aspects, Springer, New York, 27-56. https://doi.org/10.1007/978-0-387-75841-1_2</mixed-citation></ref><ref id="scirp.93947-ref10"><label>10</label><mixed-citation publication-type="other" xlink:type="simple">Petrides, D., Sapidou, E. and Calandranis, J. (1995) Computer-Aided Process Analysis and Economic Evaluation for Biosynthetic Human Insulin Production—A Case Study. Biotechnology and Bioengineering, 48, 529-541.https://doi.org/10.1002/bit.260480516</mixed-citation></ref><ref id="scirp.93947-ref11"><label>11</label><mixed-citation publication-type="other" xlink:type="simple">Sahoo, N., Choudhury, K. and Manchikanti, P. (2009) Manufacturing of Biodrugs. BioDrugs, 23, 217-229. https://doi.org/10.2165/11317110-000000000-00000</mixed-citation></ref><ref id="scirp.93947-ref12"><label>12</label><mixed-citation publication-type="other" xlink:type="simple">Hjorth, C.F., Hub&amp;aacute;lek, F., Andersson, J., Poulsen, C., Otzen, D. and Naver, H. (2015) Purification and Identification of High Molecular Weight Products Formed During Storage of Neutral Formulation of Human Insulin. Pharmaceutical Research, 32, 2072-2085. https://doi.org/10.1007/s11095-014-1600-3</mixed-citation></ref><ref id="scirp.93947-ref13"><label>13</label><mixed-citation publication-type="other" xlink:type="simple">Rotenstein, L.S., Ran, N., Shivers, J.P., Yarchoan, M. and Close, K.L. (2012) Opportunities and Challenges for Biosimilars: What’s on the Horizon in the Global Insulin Market? Clinical Diabetes, 30, 138-150. https://doi.org/10.2337/diaclin.30.4.138</mixed-citation></ref><ref id="scirp.93947-ref14"><label>14</label><mixed-citation publication-type="other" xlink:type="simple">European Medicines Agency (2017) Biosimilars in the EU: Information Guide for Healthcare Professionals. European Medicines Agency and the European Commission.</mixed-citation></ref><ref id="scirp.93947-ref15"><label>15</label><mixed-citation publication-type="other" xlink:type="simple">Standing, K.G. (2003) Peptide and Protein De Novo Sequencing by Mass Spectrometry. Current Opinion in Structural Biology, 13, 595-601.https://doi.org/10.1016/j.sbi.2003.09.005</mixed-citation></ref><ref id="scirp.93947-ref16"><label>16</label><mixed-citation publication-type="other" xlink:type="simple">Thevis, M., Thomas, A. and Sch&amp;auml;nzer, W. (2008) Mass Spectrometric Determination of Insulins and Their Degradation Products in Sports Drug Testing. Mass Spectrometry Reviews, 27, 35-50. https://doi.org/10.1002/mas.20154</mixed-citation></ref><ref id="scirp.93947-ref17"><label>17</label><mixed-citation publication-type="other" xlink:type="simple">Burns, J.A., Butler, J.C., Moran, J. and Whitesides, G.M. (1991) Selective Reduction of Disulfides by Tris (2-Carboxyethyl) Phosphine. The Journal of Organic Chemistry, 56, 2648-2650. https://doi.org/10.1021/jo00008a014</mixed-citation></ref><ref id="scirp.93947-ref18"><label>18</label><mixed-citation publication-type="other" xlink:type="simple">Cline, D.J., Redding, S.E., Brohawn, S.G., Psathas, J.N., Schneider, J.P. and Thorpe, C. (2004) New Water-Soluble Phosphines as Reductants of Peptide and Protein Disulfide Bonds: Reactivity and Membrane Permeability. Biochemistry, 43, 15195-15203. https://doi.org/10.1021/bi048329a</mixed-citation></ref><ref id="scirp.93947-ref19"><label>19</label><mixed-citation publication-type="other" xlink:type="simple">Gray, W.R. (1993) Disulfide Structures of Highly Bridged Peptides: A New Strategy for Analysis. Protein Science, 2, 1732-1748. https://doi.org/10.1002/pro.5560021017</mixed-citation></ref><ref id="scirp.93947-ref20"><label>20</label><mixed-citation publication-type="other" xlink:type="simple">Thevis, M., Thomas, A., Delahaut, P., Bosseloir, A. and Sch&amp;auml;nzer, W. (2005) Qualitative Determination of Synthetic Analogues of Insulin in Human Plasma by Immunoaffinity Purification and Liquid Chromatography-Tandem Mass Spectrometry for Doping Control Purposes. Analytical Chemistry, 77, 3579-3585. https://doi.org/10.1021/ac050066i</mixed-citation></ref><ref id="scirp.93947-ref21"><label>21</label><mixed-citation publication-type="other" xlink:type="simple">Blackburn, M. (2013) Advances in the Quantitation of Therapeutic Insulin Analogues by LC-MS/MS. Bioanalysis, 5, 2933-2946. https://doi.org/10.4155/bio.13.257</mixed-citation></ref><ref id="scirp.93947-ref22"><label>22</label><mixed-citation publication-type="other" xlink:type="simple">Thevis, M., Thomas, A., Delahaut, P., Bosseloir, A. and Sch&amp;auml;nzer, W. (2006) Doping Control Analysis of Intact Rapid-Acting Insulin Analogues in Human Urine by Liquid Chromatography-Tandem Mass Spectrometry. Analytical Chemistry, 78, 1897-1903. https://doi.org/10.1021/ac052095z</mixed-citation></ref><ref id="scirp.93947-ref23"><label>23</label><mixed-citation publication-type="other" xlink:type="simple">Thomas, A., Sch&amp;auml;nzer, W. and Thevis, M. (2014) Determination of Human Insulin and Its Analogues in Human Blood Using Liquid Chromatography Coupled to Ion Mobility Mass Spectrometry (LC-IM-MS). Drug Testing and Analysis, 6, 1125-1132. https://doi.org/10.1002/dta.1710</mixed-citation></ref><ref id="scirp.93947-ref24"><label>24</label><mixed-citation publication-type="other" xlink:type="simple">Asbury, G.R. and Hill Jr., H.H. (2000) Evaluation of Ultrahigh Resolution Ion Mobility Spectrometry as an Analytical Separation Device in Chromatographic Terms. Journal of Microcolumn Separations, 12, 172-178.https://doi.org/10.1002/(SICI)1520-667X(2000)12:3&lt;172::AID-MCS7&gt;3.0.CO;2-W</mixed-citation></ref></ref-list></back></article>