<?xml version="1.0" encoding="UTF-8"?><!DOCTYPE article  PUBLIC "-//NLM//DTD Journal Publishing DTD v3.0 20080202//EN" "http://dtd.nlm.nih.gov/publishing/3.0/journalpublishing3.dtd"><article xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink" dtd-version="3.0" xml:lang="en" article-type="research article"><front><journal-meta><journal-id journal-id-type="publisher-id">OJMS</journal-id><journal-title-group><journal-title>Open Journal of Marine Science</journal-title></journal-title-group><issn pub-type="epub">2161-7384</issn><publisher><publisher-name>Scientific Research Publishing</publisher-name></publisher></journal-meta><article-meta><article-id pub-id-type="doi">10.4236/ojms.2018.82012</article-id><article-id pub-id-type="publisher-id">OJMS-83045</article-id><article-categories><subj-group subj-group-type="heading"><subject>Articles</subject></subj-group><subj-group subj-group-type="Discipline-v2"><subject>Earth&amp;Environmental Sciences</subject></subj-group></article-categories><title-group><article-title>
 
 
  Exploring the Environmental Physiology of the Indo-Pacific Reef Coral &lt;em&gt;Seriatopora hystrix&lt;/em&gt; with Differential Proteomics
 
</article-title></title-group><contrib-group><contrib contrib-type="author" xlink:type="simple"><name name-style="western"><surname>Anderson</surname><given-names>B. Mayfield</given-names></name><xref ref-type="aff" rid="aff1"><sup>1</sup></xref><xref ref-type="corresp" rid="cor1"><sup>*</sup></xref></contrib><contrib contrib-type="author" xlink:type="simple"><name name-style="western"><surname>Yi-Jyun</surname><given-names>Chen</given-names></name><xref ref-type="aff" rid="aff2"><sup>2</sup></xref></contrib><contrib contrib-type="author" xlink:type="simple"><name name-style="western"><surname>Chi-Yu</surname><given-names>Lu</given-names></name><xref ref-type="aff" rid="aff3"><sup>3</sup></xref></contrib><contrib contrib-type="author" xlink:type="simple"><name name-style="western"><surname>Chii-Shiarng</surname><given-names>Chen</given-names></name><xref ref-type="aff" rid="aff4"><sup>4</sup></xref></contrib></contrib-group><aff id="aff4"><addr-line>Department of Marine Biotechnology and Resources, National Sun Yat-Sen University, Taiwan</addr-line></aff><aff id="aff3"><addr-line>Department of Biochemistry, College of Medicine, Kaohsiung Medical University, Taiwan</addr-line></aff><aff id="aff1"><addr-line>Khaled bin Sultan Living Oceans Foundation, USA</addr-line></aff><aff id="aff2"><addr-line>Taiwan Coral Research Center, Taiwan</addr-line></aff><author-notes><corresp id="cor1">* E-mail:<email>andersonblairmayfield@gmail.com(ABM)</email>;</corresp></author-notes><pub-date pub-type="epub"><day>11</day><month>02</month><year>2018</year></pub-date><volume>08</volume><issue>02</issue><fpage>223</fpage><lpage>252</lpage><history><date date-type="received"><day>25,</day>	<month>January</month>	<year>2018</year></date><date date-type="rev-recd"><day>12,</day>	<month>March</month>	<year>2018</year>	</date><date date-type="accepted"><day>15,</day>	<month>March</month>	<year>2018</year></date></history><permissions><copyright-statement>&#169; Copyright  2014 by authors and Scientific Research Publishing Inc. </copyright-statement><copyright-year>2014</copyright-year><license><license-p>This work is licensed under the Creative Commons Attribution International License (CC BY). http://creativecommons.org/licenses/by/4.0/</license-p></license></permissions><abstract><p>
 
 
  
    Although reef-building corals are threatened by a number of anthropogenic impacts, certain scleractinian-dinoflagellate (genus
   <em> Symbiodinium</em>) endosymbioses have proven markedly resilient to environmental change. For instance, corals from upwelling habitats of Southern Taiwan withstand both short- and long-term increases in temperature, potentially due to their routine exposure to highly variable temperature regimes 
   <em>in situ</em>. To gain a greater understanding of the proteomic basis for such acclimatization to unstable environmental conditions, specimens of the Indo-Pacific reef-building coral 
   <em>Seriatopora hystrix</em> Dana 1846 were sampled during a period of stable temperature conditions from 1) a site characterized by frequent upwelling events in Southern Taiwan and 2) a nearby, non-upwelling control site in the Taiwan Strait. Two-dimensional gel electrophoresis followed by sequencing of differentially concentrated proteins with mass spectrometry unveiled significantly more proteins involved in the cellular stress response in coral hosts of the upwelling site. Although such stress protein signatures could be indicative of sub-lethal levels of cellular stress, especially given the relatively higher sediment loads characteristic of the upwelling site, these proteins may, in contrast, have been constitutively maintained at high levels in preparation for large fluctuations in temperature and other abiotic parameters (
   <em>e.g</em>., nutrient levels) brought upon by upwelling events. 
  
 
</p></abstract><kwd-group><kwd>Acclimation</kwd><kwd> Coral Reefs</kwd><kwd> Dinoflagellate</kwd><kwd> Environmental Physiology</kwd><kwd> Marine Biology</kwd><kwd> Marine Invertebrates</kwd><kwd> Molecular Biology</kwd><kwd> Proteomics</kwd><kwd> Taiwan</kwd></kwd-group></article-meta></front><body><sec id="s1"><title>1. Introduction</title><p>As Earth’s oceans continue to warm and acidify [<xref ref-type="bibr" rid="scirp.83045-ref1">1</xref>] , scientists are racing to understand the physiological implications of such climate change impacts on marine organisms [<xref ref-type="bibr" rid="scirp.83045-ref2">2</xref>] ; there has been a particular focus on taxa known to be environmentally-sensitive, such as reef-building corals [<xref ref-type="bibr" rid="scirp.83045-ref3">3</xref>] . Although it is true that many scleractinian-dinoflagellate (genus Symbiodinium) endosymbioses readily disintegrate (i.e., “bleach”) upon prolonged exposure to unfavorable environmental conditions [<xref ref-type="bibr" rid="scirp.83045-ref4">4</xref>] , certain species/populations have proven to be markedly plastic and readily acclimatize/acclimate to an array of different environmental conditions in situ [<xref ref-type="bibr" rid="scirp.83045-ref5">5</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref6">6</xref>] , as well as in the laboratory [<xref ref-type="bibr" rid="scirp.83045-ref7">7</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref8">8</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref9">9</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref10">10</xref>] .</p><p>Southern Taiwan has served as an exemplary natural laboratory for understanding how environmental heterogeneity influences coral biology, as there are well-developed coral reefs experiencing very different oceanographic conditions in near vicinity of each other [<xref ref-type="bibr" rid="scirp.83045-ref11">11</xref>] . For instance, corals of Houwan (HWN), a reef within the Taiwan Strait (<xref ref-type="fig" rid="fig1">Figure 1</xref>), experience a relatively stable environment with respect to seawater temperature [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] , which rarely</p><p>fluctuates more than a 1 - 2˚C within a single day. In contrast, the thermal environment of nearby (~15 km) Houbihu (HBH), which is just around the Maobitou Cape within Nanwan Bay (Taiwan’s southernmost embayment; <xref ref-type="fig" rid="fig1">Figure 1</xref>), differs dramatically [<xref ref-type="bibr" rid="scirp.83045-ref13">13</xref>] ; Nanwan Bay experiences spring tide-induced upwelling events in the boreal summer, during which temperature can change by up to 9˚C in just a few hours.</p><p>To gain greater insight into the molecular biology underlying the ability of corals to thrive in these upwelling environments, biopsies of the common, Indo-Pacific scleractinian Seriatopora hystrix Dana 1846 were taken from the same colonies from which laboratory-based experiments were previously conducted [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] immediately upon removal of the colonies from the ocean at each of the two aforementioned study sites in Southern Taiwan, HBH (the upwelling site) and HWN (the non-upwelling site), during a stable-temperature period (i.e., between upwelling events in the case of HBH). It was hypothesized that a two-dimensional (2D) gel electrophoresis approach followed by sequencing of proteins uniquely synthesized by corals of one site and not the other (i.e., uniquely synthesized proteins [USPs]) with mass spectrometry (MS) could aid in elucidating the proteomic basis of survival in a highly variable-temperature environment. Indeed, proteomics-based approaches have aided in our understanding of both the fundamental cell biology of anthozoan-dinoflagellate endosymbioses (e.g., [<xref ref-type="bibr" rid="scirp.83045-ref18">18</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref19">19</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref20">20</xref>] ), as well as their responses to high temperatures [<xref ref-type="bibr" rid="scirp.83045-ref21">21</xref>] , and it was hypothesized that a number of proteins would be differentially concentrated (i.e., differentially concentrated proteins [DCPs]) between corals of the two study sites; such USPs/DCPs might be linked to cellular processes involved in combatting the major abiotic challenges facing the corals of each habitat.</p></sec><sec id="s2"><title>2. Materials and Methods</title><sec id="s2_1"><title>2.1. Study Sites</title><p>Both the upwelling site HBH (21˚56'18.01&quot;N, 120˚44'45.54&quot;E) and the non-upwelling site HWN (22˚01'23.30&quot;N, 120˚41'18.29&quot;E) have been well characterized with respect to their oceanography [<xref ref-type="bibr" rid="scirp.83045-ref13">13</xref>] and coral reef ecology (e.g., [<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref23">23</xref>] ). Although the difference in temperature variability between study sites was the sole focus of prior environmental physiology works on seriatoporid corals from HBH and HWN [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] , other oceanographic variables were shown by Liu et al. [<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>] to differ between them, and these additional seawater quality parameters could likewise influence the physiology of the resident corals. We therefore undertook a meta-analysis of seawater quality at each site by pooling our own published data ( [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] ) with those of Liu et al. [<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>] . We now briefly review how these data were collected.</p></sec><sec id="s2_2"><title>2.2. Oceanographic and Ecological Data Collection</title><p>The temperature regimes of both the upwelling site HBH and the non-upwelling, Taiwan Strait, control site HWN (<xref ref-type="fig" rid="fig1">Figure 1</xref>) were characterized in detail in 2010 at 7 - 8 m depth (the depth of coral collection [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] ); specifically, temperature was measured at hourly intervals with HOBO&#174; Pendant data loggers (Onset) for one year. Although the mean annual temperature did not differ between the two sites, the variability did (<xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>); the mean monthly temperature range was 2-fold higher at HBH than HWN due to spring-tide upwelling events that occur during the boreal summer at the former site only [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] .</p><p>As mentioned above, prior works on seriatoporid corals from HBH and HWN have focused mainly on these temperature differences as being responsible for the physiological heterogeneity documented across the sampled coral colonies (e.g., [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] ). However, we considered additional seawater quality parameters herein as being potential drivers of physiological variation between corals of the two study sites by incorporating the data from Liu et al. [<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>] , in which stations 2 and 7 - 8 correspond to HWN and HBH, respectively. Specifically, Liu et al. [<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>] measured salinity, pH, dissolved oxygen (DO) content (%), biochemical oxygen demand (BOD<sub>5</sub>; mg/L), suspended solid levels (mg/L), turbidity (NTU), and concentrations of nitrite (μg/L), nitrate (μg/L), ammonia (μg/L), phosphate (μg/L), silicate (μg/L), and chlorophyll a (chl-a; μg/L) at monthly intervals between 2001 and 2008, and their respective averages across this timespan have been included in <xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>. Photosynthetically active radiation (PAR) was instead measured at the depth of coral collection (7 - 8 m) at hourly intervals by Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] , with the mean hourly daytime PAR calculated across several days in May 2010 (the month of coral collection) presented in <xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>. Finally, coral cover was estimated at each site as in Tkachenco et al. [<xref ref-type="bibr" rid="scirp.83045-ref24">24</xref>] , with modifications made by Liu et al. [<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>] , and the mean average live coral cover (ALCC) values of the latter work have been included in <xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref> for both study sites. Data were compared statistically across sites as described below.</p></sec><sec id="s2_3"><title>2.3. Coral Sampling and Incorporation of Data from Past Studies</title><p>Sampling of six S. hystrix colonies (see insets of <xref ref-type="fig" rid="fig1">Figure 1</xref>) was undertaken at each site in May 2010 (a month in which upwelling events were frequent [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] ) during a period of stable (i.e., non-upwelling) temperatures (~26˚C) as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] . Only visibly healthy corals were sampled, and there were no evident signs of stress (e.g., excessive release of mucus, bacterial infection, bleaching, recent tissue loss, etc.) in any of the 12 colonies. Once at the surface, three small (~50 mg) biopsies taken from each colony were submerged in ~2 ml of TRIzol™ (Life Technologies), and the 36 biopsies were later homogenized with a mortar and pestle at the lab as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] . Additional tissue biopsies were taken immediately upon removal of the colonies from the ocean in order to determined in situ chl-a content and Symbiodinium density (described in detail in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] ). The colonies from which these “in situ biopsies” were taken were transported to the laboratory and fragmented into nubbins for use in a laboratory-based reciprocal transplant [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] . Physiological- and molecular-scale</p><table-wrap-group id="1"><label><xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref></label><caption><title> Oceanographic differences between the two study sites and physiological variation between their resident seriatoporid corals. Please note that all coral physiological and molecular response variables were assessed only after four weeks of husbandry except for the following: chlorophyll a (chl-a; in situ and post-husbandry data obtained), maximum quantum yield of photosystem II (Fv/Fm; in situ and post-husbandry data obtained), Symbiodinium (Sym) density (in situ and post-husbandry data obtained), and two-dimensional (2D) gel electrophoresis + mass spectrometry (MS)-derived protein concentrations (in situ [herein] and post-husbandry data [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] obtained); in the case of the former three parameters only, their in situ values are instead included in the table. All values in the “HBH” (Houbihu) and “HWN” (Houwan) columns represent means (&#177;std. dev.) unless noted otherwise. In the “Conclusion” column, “&lt;” and/or “&gt;” denote statistically significant differences between sites (P &lt; 0.05). ALCC = average live coral cover. exp. = experiment. GCP = genome copy proportion (a molecular proxy for Sym density). PAR = photosynthetically active radiation. SE = standard error. For full gene names, please see the respective references</title></caption><table-wrap id="1_1"><table><tbody><thead><tr><th align="center" valign="middle" >Parameter</th><th align="center" valign="middle" >HBH</th><th align="center" valign="middle" >HWN</th><th align="center" valign="middle"  colspan="2"  >Type of test</th><th align="center" valign="middle" >Conclusion</th><th align="center" valign="middle" >Effect of husbandry</th><th align="center" valign="middle" >Ref(s)</th></tr></thead><tr><td align="center" valign="middle"  colspan="8"  >Seawater quality &amp; ALCC (in situ data)</td></tr><tr><td align="center" valign="middle" >Temperature (˚C)-monthly mean</td><td align="center" valign="middle" >26.4 &#177; 1.8</td><td align="center" valign="middle"  colspan="2"  >26.6 &#177; 2.0</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >Not applicable (NA)</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Temperature (˚C)-monthly range</td><td align="center" valign="middle" >6.3 &#177; 2.0</td><td align="center" valign="middle"  colspan="2"  >3.2 &#177; 0.6</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH &gt; HWN (2-fold)</td><td align="center" valign="middle" >NA</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Salinity</td><td align="center" valign="middle" >32.7 &#177; 0.5 (SE)</td><td align="center" valign="middle"  colspan="2"  >32.4 &#177; 0.23 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >Not significant (NS)</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >Light at 7.5 m (PAR; μmol/m<sup>2</sup>/s)</td><td align="center" valign="middle" >94 &#177; 9.1</td><td align="center" valign="middle"  colspan="2"  >94 &#177; 8.6</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >NS</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >pH</td><td align="center" valign="middle" >8.28 &#177; 0.03 (SE)</td><td align="center" valign="middle"  colspan="2"  >8.29 &#177; 0.02 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >Not determined (ND)</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >Dissolved oxygen (%)</td><td align="center" valign="middle" >118 &#177; 3.0 (SE)</td><td align="center" valign="middle"  colspan="2"  >126 &#177; 2.9 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >BOD<sub>5</sub> (mg/L)</td><td align="center" valign="middle" >1.1 &#177; 0.1 (SE)</td><td align="center" valign="middle"  colspan="2"  >1.3 &#177; 0.1 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >[Nitrite] (μg/L)</td><td align="center" valign="middle" >2.5 &#177; 0.5 (SE)</td><td align="center" valign="middle"  colspan="2"  >7 &#177; 4 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >[Nitrate] (μg/L)</td><td align="center" valign="middle" >49 &#177; 13 (SE)</td><td align="center" valign="middle"  colspan="2"  >53 &#177; 9 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >[Ammonia] (μg/L)</td><td align="center" valign="middle" >35 &#177; 11 (SE)</td><td align="center" valign="middle"  colspan="2"  >63 &#177; 21 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >[Phosphate] (μg/L)</td><td align="center" valign="middle" >3.5 &#177; 1.5 (SE)</td><td align="center" valign="middle"  colspan="2"  >9 &#177; 3 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >[Silicate] (μg/L)</td><td align="center" valign="middle" >600 &#177; 60 (SE)</td><td align="center" valign="middle"  colspan="2"  >400 &#177; 80 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH &gt; HWN (1.5-fold)</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >[Suspended solids] (mg/L)</td><td align="center" valign="middle" >20 &#177; 3 (SE)</td><td align="center" valign="middle"  colspan="2"  >12 &#177; 2 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH &gt; HWN (1.6-fold)</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >Turbidity (NTU)</td><td align="center" valign="middle" >7.2 &#177; 1.6 (SE)</td><td align="center" valign="middle"  colspan="2"  >3.3 &#177; 0.8 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH &gt; HWN (2-fold)</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >[Chl-a] (μg/L)</td><td align="center" valign="middle" >0.26 &#177; 0.07 (SE)</td><td align="center" valign="middle"  colspan="2"  >0.25 &#177; 0.03 (SE)</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle" >ALCC (%)</td><td align="center" valign="middle" >43 &#177; 25</td><td align="center" valign="middle"  colspan="2"  >28 &#177; 25</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref22">22</xref>]</td></tr><tr><td align="center" valign="middle"  colspan="8"  >Coral physiology and biological composition (in situ data for all response variables except growth, RNA/DNA ratio, protein/DNA ratio, and the Sym GCP)</td></tr><tr><td align="center" valign="middle" >Growth (mg/cm<sup>2</sup>/day)</td><td align="center" valign="middle" >0.8 &#177; 0.2</td><td align="center" valign="middle" >0.7 &#177; 0.2</td><td align="center" valign="middle"  colspan="2"  >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND (did not assess in situ)</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Sym density (cells/cm<sup>2</sup>)</td><td align="center" valign="middle" >3.1 &#177; 1.0</td><td align="center" valign="middle" >3.0 &#177; 0.3</td><td align="center" valign="middle"  colspan="2"  >Wilcoxon test<sup>a</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >Yes (increased), HWN &gt; HBH post-exp.</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>]</td></tr><tr><td align="center" valign="middle" >Areal chl-a (μg/cm<sup>2</sup>)</td><td align="center" valign="middle" >2.8 &#177; 1.2</td><td align="center" valign="middle" >3.1 &#177; 0.8</td><td align="center" valign="middle"  colspan="2"  >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >Yes (increased), HBH &gt; HWN post-exp.</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>]</td></tr><tr><td align="center" valign="middle" >Chl-a/cell (pg/cell)</td><td align="center" valign="middle" >0.9 &#177; 0.3</td><td align="center" valign="middle" >1.0 &#177; 0.3</td><td align="center" valign="middle"  colspan="2"  >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >Yes (increased)</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>]</td></tr><tr><td align="center" valign="middle" >Fv/Fm (dark-adapted)</td><td align="center" valign="middle" >0.74 &#177; 0.01</td><td align="center" valign="middle" >0.75 &#177; 0.01</td><td align="center" valign="middle"  colspan="2"  >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >Yes (increased), HBH &gt; HWN post-exp.</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>]</td></tr><tr><td align="center" valign="middle" >RNA/DNA ratio</td><td align="center" valign="middle" >0.4 &#177; 0.2</td><td align="center" valign="middle" >0.4 &#177; 0.1</td><td align="center" valign="middle"  colspan="2"  >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td></tr></tbody></table></table-wrap><table-wrap id="1_2"><table><tbody><thead><tr><th align="center" valign="middle" >Parameter</th><th align="center" valign="middle" >HBH</th><th align="center" valign="middle" >HWN</th><th align="center" valign="middle" >Type of test</th><th align="center" valign="middle" >Conclusion</th><th align="center" valign="middle" >Effect of husbandry</th><th align="center" valign="middle" >Ref (s)</th></tr></thead><tr><td align="center" valign="middle" >Protein/DNA ratio</td><td align="center" valign="middle" >13 &#177; 4</td><td align="center" valign="middle" >18 &#177; 6</td><td align="center" valign="middle" >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HWN &gt; HBH (1.4-fold)</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Sym GCP</td><td align="center" valign="middle" >16 &#177; 7</td><td align="center" valign="middle" >15 &#177; 6</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle"  colspan="7"  >Sym gene expression (normalized to the exogenous Solaris&#174; RNA spike &amp; Sym GCP as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref55">55</xref>] ; in situ gene expression levels were not determined.)</td></tr><tr><td align="center" valign="middle" >Sym apx1 (stress response)</td><td align="center" valign="middle" >2.8 &#177; 1.4</td><td align="center" valign="middle" >3.5 &#177; 2.5</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Sym hsp70 (stress response)</td><td align="center" valign="middle" >670 &#177; 270</td><td align="center" valign="middle" >740 &#177; 290</td><td align="center" valign="middle" >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Sym pgpase (photosynthesis)</td><td align="center" valign="middle" >12 &#177; 5.2</td><td align="center" valign="middle" >13 &#177; 7.4</td><td align="center" valign="middle" >student’s t-test<sup>c</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Sym psI (photosynthesis)</td><td align="center" valign="middle" >101 &#177; 50</td><td align="center" valign="middle" >74 &#177; 51</td><td align="center" valign="middle" >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH &gt; HWN (1.5-fold)</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Sym rbcL (photosynthesis)</td><td align="center" valign="middle" >30 &#177; 21</td><td align="center" valign="middle" >40 &#177; 35</td><td align="center" valign="middle" >student’s t-test<sup>c</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>]</td></tr><tr><td align="center" valign="middle" >Sym nrt2 (metabolism)</td><td align="center" valign="middle" >750 &#177; 230</td><td align="center" valign="middle" >1060 &#177; 760</td><td align="center" valign="middle" >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle"  colspan="7"  >Host coral gene expression (normalized to the exogenous Solaris&#174; RNA spike &amp; host GCP as in Putnam et al. [<xref ref-type="bibr" rid="scirp.83045-ref56">56</xref>] ; in situ gene expression levels were not determined.)</td></tr><tr><td align="center" valign="middle" >Host hsp70 (stress response)</td><td align="center" valign="middle" >75 &#177; 12</td><td align="center" valign="middle" >71 &#177; 11</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Host actb (cytoskeleton)</td><td align="center" valign="middle" >110 &#177; 31</td><td align="center" valign="middle" >107 &#177; 33</td><td align="center" valign="middle" >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Host ezrin (cytoskeleton)</td><td align="center" valign="middle" >58 &#177; 35</td><td align="center" valign="middle" >80 &#177; 27</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Host trp1 (cytoskeleton)</td><td align="center" valign="middle" >23 &#177; 8.2</td><td align="center" valign="middle" >28 &#177; 8.5</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Host tuba (cytoskeleton)</td><td align="center" valign="middle" >230 &#177; 81</td><td align="center" valign="middle" >220 &#177; 51</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Host cplap2 (osmoregulation)</td><td align="center" valign="middle" >1.5 &#177; 0.66</td><td align="center" valign="middle" >2.1 &#177; 0.78</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Host oatp (osmoregulation)</td><td align="center" valign="middle" >5.7 &#177; 2.6</td><td align="center" valign="middle" >5.4 &#177; 1.6</td><td align="center" valign="middle" >student’s t-test</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle" >Host trcc (osmoregulation)</td><td align="center" valign="middle" >210 &#177; 81</td><td align="center" valign="middle" >210 &#177; 76</td><td align="center" valign="middle" >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>]</td></tr><tr><td align="center" valign="middle"  colspan="7"  >Sym protein expression (western blot-derived; concentration normalized to the Sym GCP)</td></tr><tr><td align="center" valign="middle" >Sym RBCL (photosynthesis)</td><td align="center" valign="middle" >320 &#177; 170</td><td align="center" valign="middle" >200 &#177; 94</td><td align="center" valign="middle" >student’s t-test<sup>b</sup></td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>]</td></tr><tr><td align="center" valign="middle"  colspan="3"  >All 23 response variables listed above (standardized)</td><td align="center" valign="middle" >PERMANOVA</td><td align="center" valign="middle" >HBH = HWN</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >herein</td></tr><tr><td align="center" valign="middle" >Protein expression (2D + MS)</td><td align="center" valign="middle" >15 proteins across 3 sequenced spots</td><td align="center" valign="middle" >38 proteins across 6 sequenced spots</td><td align="center" valign="middle" >See text for details.</td><td align="center" valign="middle" >See text for details.</td><td align="center" valign="middle" >ND</td><td align="center" valign="middle" >Herein &amp; [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>]</td></tr></tbody></table></table-wrap></table-wrap-group><p><sup>a</sup>unequal variance; <sup>b</sup>log-transformed data; <sup>c</sup>square root-transformed data.</p><p>data from the same coral colonies as those analyzed herein ( [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] ) have been summarized in <xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref> in a similar manner as for the previously acquired seawater quality data in order to more thoroughly assess environmental differences in the physiology of S. hystrix in Southern Taiwan. This meta analysis was also carried out to better understand the effect of experimental husbandry on coral physiology (sensu Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] ), since Symbiodinium densities and chl-a concentrations, as well as the maximum dark-adapted yield of photosystem II (Fv/Fm), were documented both in situ and after four weeks of aquarium husbandry for corals of both study sites.</p></sec><sec id="s2_4"><title>2.4. Coral Protein Extraction, 2D Gel Electrophoresis, and MS</title><p>Proteins from one of the three technical replicates from each of three randomly chosen colonies from each of the two sites were purified as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] . These six samples represent those biopsies preserved immediately upon removal from the source colonies from the ocean and were therefore meant to be representative of “in situ protein concentrations.” Proteins (n = 6) were extracted as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref25">25</xref>] , precipitated in acetone, washed, dried, dissolved in ~150 μL of rehydration buffer (9.5 M urea, 2% CHAPS, 0.5% carrier ampholytes, and 65 mM dithiothreitol), and 20 μL of solubilized protein were quantified with the 2D Quant kit (Amersham Biosciences). The transcriptomes of all 12 colonies, including the 6 whose proteomes were analyzed herein, were sequenced previously [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] , albeit after three weeks of acclimation and one week of experimentation (stable vs. variable temperature regimes [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] ).</p><p>Proteins (~130 μg) were electrophoresed across 2D as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] ; however, as this book chapter is not freely available except on ABM’s personal website (http://coralreefdiagnostics.com/), certain key details, which can also be found in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref26">26</xref>] , been reiterated below. Briefly, upon electrophoresing the protein samples (n = 3 for each of two sites of origin: HBH vs. HWN) across 2D (isoelectric focusing for isoelectric point [pI] determination and SDS-PAGE for molecular weight [in kDa] determination) as described in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref26">26</xref>] , gels were fixed and stained with SYPRO&#174; Ruby (Life Technologies). They were then imaged by a Typhoon Trio™ scanner (GE Healthcare), and ImageQuant TL software (GE Healthcare) was used to identify USPs, or, when USPs were not uncovered, DCPs, between each pair of HBH and HWN gels. Two gels were run simultaneously on each of three days: one HWN sample and one HBH sample. DCP/USP pIs and molecular weights were recorded from the 1<sup>st</sup> and 2<sup>nd</sup> HBH vs. HWN gel pairs. When these same protein spots were also differentially concentrated between gels, or uniquely synthesized by corals of one of the two sites, in the third pair of biological replicates, they were removed from the gel in which their concentration was higher (referred to herein as the “representative” gel), digested with trypsin, and prepared for MS as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref26">26</xref>] .</p><p>In general, only protein spots that were uniquely synthesized by coral samples of one site and not the other in all three pairs of gels were removed from the final, representative gel and sequenced, though two protein spots that were instead more concentrated by HBH samples in all three gel pairs (i.e., DCPs, rather than USPs) were removed from the final HBH gel and analyzed by MS. In total three HBH &gt; HWN and six HWN &gt; HBH spots were in-gel digested with trypsin and purified as in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref26">26</xref>] . Then, 2 μL of purified, trypsin-digested peptides were injected into a nano-liquid chromatography system and detected by an LTQ Orbitrap “Discovery Hybrid Fourier Transform” mass spectrometer (Thermo-Fisher) at a resolution of 30,000 coupled with a nanospray source that was executed in positive ion mode. The nano-UPLC system (“nanoACQUITY”), desalting (Symmetry C18; 5 μm &#215; 180 μm &#215; 20 mm), and analytical (BEH C18; 1.7 μm &#215; 75 μm &#215; 150 mm) columns were all purchased from Waters. The peptide eluate from the column was directed to the nanospray source, and the MS was operated in data-dependent mode.</p></sec><sec id="s2_5"><title>2.5. Data Analysis-I: Oceanographic, Ecological, and Target Response Variable Data</title><p>When oceanographic (e.g., temperature), ecological (ALCC), and molecular physiological (i.e., the 23 response variables analyzed previously in the sampled colonies; <xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>) data were normally distributed and of homogeneous variance across the two study sites, their means were compared across sites with student’s t-tests. Wilcoxon tests were used when log- or square root-transformations did not lead to normally distributed (Shapiro-Wilk test, P &lt; 0.05) or homogeneously variable (Levene’s test, P &lt; 0.05) datasets between sites. In certain cases, both in situ data (Symbiodinium density, Fv/Fm, and chl-a content) and data following four weeks of experimental husbandry (described in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] ) were available. In these cases, repeated-measures ANOVAs were instead used to determine whether husbandry had a differential effect on corals of the two study sites. All univariate statistical analyses were carried out with JMP&#174; (ver. 12.0.1). Finally, a multivariate approach aimed at modeling site differences in coral physiology (sensu Mayfield [<xref ref-type="bibr" rid="scirp.83045-ref27">27</xref>] ) was carried out with PRIMER (ver. 6) with all 23 response variables (standardized prior to analysis), testing site of origin as the fixed factor. PERMANOVA is based on similarity (Bray-Curtis) between samples and so does not require that data are normally distributed and of homogenous variance (as does MANOVA, which is sensitive to significant deviations from normality and cannot be used in cases such as this study in which there are more response variables [n = 23] than samples [n = 12]).</p></sec><sec id="s2_6"><title>2.6. Data Analysis-II: MS</title><p>.MGF data files from the mass spectrometer (n = 6) were directly uploaded into the MS-SCAN program featured on the S. hystrix-Symbiodinium transcriptome server (http://symbiont.iis.sinica.edu.tw/s_hystrix/static/html/#mscan), and all default conditions of the MS-GF+ script [<xref ref-type="bibr" rid="scirp.83045-ref28">28</xref>] upon which MS-SCAN is based were used (discussed on the open access website housing the script: https://omics.pnl.gov/software/ms-gf); this included up to two missed cleavages allowed. However, as 1) Chiva et al. [<xref ref-type="bibr" rid="scirp.83045-ref29">29</xref>] found that sequence datasets featuring such missed cleavages are not inherently biased with respect to quantification, and 2) Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] found the S. hystrix-Symbiodinium proteome to be lysine- and arginine-rich, we generally included sequences containing over two missed cleavages provided that either 15 amino acids (AA) were sequenced at minimum or, alternatively, two peptides mapped to the same reference protein whose collective length was ≥15 AA. A decoy database (sensu [<xref ref-type="bibr" rid="scirp.83045-ref30">30</xref>] ) was not queried to calculate a false discovery rate since there is no fully sequenced proteome for a coral or Symbiodinium. Instead, the aforementioned peptide length criteria were increased above the default minimum of 6 AA of MS-GF+ to ensure that only peptides that could be identified with confidence were considered in the analysis. This undoubtedly reduced the total number of DCPs identified. Additional details of MS-GF+, which, unlike Mascot (Matrix Sciences), is free, can be found in Kim and Pevzner [<xref ref-type="bibr" rid="scirp.83045-ref28">28</xref>] .</p><p>When peptides could be identified with confidence (≥15 AA mapping to a translated contig in the S. hystrix-Symbiodinium transcriptome) with MS-SCAN, they were assigned a compartment of origin (host, Symbiodinium, intermediate [either host coral or Symbiodinium], or unknown), as well as a protein identity and functional category (e.g., metabolism) when the top hit contig (mRNA) hypothetically encoding the sequenced peptide aligned significantly (e &lt; 10<sup>−</sup><sup>5</sup>) to a functionally characterized protein in the NCBI nr database. The full mRNA sequence of the top hit contig derived from MS-SCAN analysis of the spectral data, rather than the peptide sequence itself, was used as the query (BLASTx) of the NCBI database; this is because trypsin-digested peptides are generally short (mean length = 22 &#177; 9 [std. dev.] AA herein; see <xref ref-type="table" rid="table">Table </xref>S1 located at the end of the manuscript.), and such short sequences may not align significantly to any homolog on a public sequence repository like NCBI. However, when &gt;30 contiguous AA were sequenced from a single protein, the peptide sequence itself was additionally BLASTed (BLASTp) against the NCBI database to attempt to corroborate the BLASTx analysis of the respective mRNA.</p><p>The compartmental breakdowns of the differentially concentrated proteomes were compared to the S. hystrix: Symbiodinium mRNA ratio of 1.8 [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] with z-tests. This approach aimed to determine whether one member of the endosymbiosis contributed relatively more USPs/DCPs than the other for 1) all DCPs, 2) the HWN &gt; HBH DCPs, and 3) the HBH &gt; HWN DCPs. Two-sample proportion tests were used to determine whether 1) certain functional categories differed in proportional abundance between the HWN &gt; HBH and HBH &gt; HWN proteomes and 2) certain functional categories were significantly over-represented relative to the stable vs. variable differentially concentrated proteome of Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] . For all such statistical analyses, an alpha level of 0.05 was established a priori.</p><p>As the transcriptomes of nubbins generated from the colonies analyzed herein were sequenced previously (6 nubbins from each site of origin sequenced after one month of experimental husbandry [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] ), the expression data from all mRNAs encoding the 53 DCPs uncovered herein were acquired from the S. hystrix-Symbiodinium transcriptome server (http://symbiont.iis.sinica.edu.tw/s_hystrix/static/html/#stat), and 2-way ANOVAs were performed to determine the effects of site of origin (HWN vs. HBH), temperature treatment (stable vs. variable; see Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] for details.), and their interaction. When a site of origin difference was statistically significant (P &lt; 0.05) and matched that observed at the protein level documented herein, congruency between mRNA expression and protein concentration was said to have occurred. For instance, if the 2-way ANOVA revealed that a gene was expressed at 2-fold-higher levels in corals of HBH, and the protein spot was more highly concentrated (or uniquely identified) in the final, representative HBH protein gel, molecular congruency was deemed to have been verified. Two-sample proportion tests were used to determine whether congruency differed significantly across 1) compartments (host coral vs. Symbiodinium), 2) site of origin (HBH vs. HWN), and 3) experiments (this study compared to a variable temperature study performed with these same samples [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] ).</p></sec></sec><sec id="s3"><title>3. Results</title><sec id="s3_1"><title>3.1. Seawater Quality</title><p>Although most seawater quality parameters were similar between HWN and HBH, several differed significantly upon pooling data over an eight-year period (<xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>); notably, silicate concentration, suspended solid levels, and turbidity were all significantly higher at HBH (P &lt; 0.05), which abuts a marina, than HWN, which is adjacent to Taiwan’s National Museum of Marine Biology and Aquarium (NMMBA; <xref ref-type="fig" rid="fig1">Figure 1</xref>; where all laboratory work was undertaken). As reported previously [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] , the mean monthly temperature range at HBH of ~6˚C was approximately double that of HWN (~3˚C; <xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>) in the year of coral sampling (2010).</p></sec><sec id="s3_2"><title>3.2. Overview of Coral Physiology Results</title><p>In addition to the 2D + MS results generated herein, we aimed to first provide a brief overview of previous findings obtained from these same coral colonies. We first summarize the influence of a one-month experimental husbandry on coral nubbins from the two study sites that were fragmented from the same source colonies from which biopsies were taken herein for 2D + MS analysis (“Effect of experimental husbandry”); these findings are described in detail in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] . Then, we briefly summarize the findings of two prior works (Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] ) in which 23 molecular-physiological response variables were measured in coral nubbins generated from the same source colonies as those analyzed herein, albeit exposed to stable or variable temperatures for one week (following three weeks of acclimation; “Coral molecular physiology differences between upwelling (HBH) and non-upwelling (HWN) study sites”). Upon presenting the 2D + MS data produced herein (“2D + MS”), we then compare the results obtained to those of another study with these same samples [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] that instead sought to model temperature-related, rather than site of origin-associated, differences in protein concentrations (“Comparison with a stable vs. variable temperature regime study carried out with S. hystrix”). It should be mentioned that all 12 colonies were of the identical genotype (determined by analysis of microsatellites [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] ) and hosted Symbiodinium of clade C exclusively [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] .</p></sec><sec id="s3_3"><title>3.3. Effect of Experimental Husbandry</title><p>As discussed in more detail in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref14">14</xref>] , some coral response variables did change in response to four weeks of experimental husbandry (three weeks of 26˚C-acclimation and one week of experimentation [stable vs. variable temperature regime]; see Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] for details.), and husbandry differentially affected corals of the two sites; Symbiodinium density increased more after four weeks of husbandry for corals of HWN than for those of HBH, whereas chl-a concentration and Fv/Fm increased more over this period for corals of HBH (<xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>).</p></sec><sec id="s3_4"><title>3.4. Coral Molecular Physiology Differences between Upwelling (HBH) and Non-Upwelling (HWN) Study Sites</title><p>Of the 23 response variables measured in corals of the two study sites (<xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>; see Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] for details.), only the protein/DNA ratio and Symbiodinium photosystem I (subunit III; psI) mRNA expression differed significantly between corals of the upwelling and non-upwelling sites (<xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>). Regarding the former, S. hystrix colonies of HWN were characterized by 1.4-fold higher protein/DNA ratios than colonies of the same genotype and Symbiodinium assemblages of HBH. It should be mentioned that, despite this difference, equal quantities of protein were loaded into all 2D gels. In contrast, psI mRNA expression was 1.5-fold higher in Symbiodinium (clade C [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] ) populations within corals of HBH. Although PERMANOVA did not detect a multivariate effect of site of origin across the 23 response variables (<xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>), it is possible that a hypothesis-neutral, proteomics-based approach could nevertheless uncover site-related differences in coral proteo-biology; such was indeed the case, and these findings are discussed in detail below.</p></sec><sec id="s3_5"><title>3.5. 2D + MS</title><p>Of the 6 and 3 protein spots concentrated at higher levels by samples of HWN (<xref ref-type="fig" rid="fig2">Figure 2</xref>(a)) and HBH (<xref ref-type="fig" rid="fig2">Figure 2</xref>(b)), respectively, 6 and 1, respectively, were uniquely synthesized by corals of one site of origin and not the other; two DCPs were additionally isolated from the representative HBH gel (<xref ref-type="fig" rid="fig2">Figure 2</xref>(b)). From the 6 HWN &gt; HBH and 3 HBH &gt; HWN protein spots, 38 (<xref ref-type="table" rid="table">Table </xref>2) and 15 (<xref ref-type="table" rid="table">Table </xref>3) proteins, respectively, were identified with MS-SCAN using the S. hystrix-Symbiodinium transcriptome as a reference database (<xref ref-type="fig" rid="fig3">Figure 3</xref>). Regarding the compartmental breakdown of all 53 proteins identified (<xref ref-type="fig" rid="fig3">Figure 3</xref>(a)), 55 and 38% were of host coral and Symbiodinium origin, respectively. This 1.4:1 ratio did not differ significantly from the 1.8:1 mRNA ratio of this coral [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] (z-test, P &gt; 0.05), nor did it differ from the 1.6:1 host/Symbiodinium DCP ratio of another proteomic study of S. hystrix [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] (2-sample proportion test, P &gt; 0.05).</p><p>With respect to the functional breakdown of all 49 proteins that could be assigned a compartment of origin (<xref ref-type="fig" rid="fig3">Figure 3</xref>(d)), nearly half aligned to proteins that had not been characterized. Of the remaining 28 proteins (57%) that did</p><p>align to characterized proteins, the dominant functional categories were cytoskeleton, stress response, transport, and transcription. Of the 14 HBH &gt; HWN DCPs (<xref ref-type="fig" rid="fig3">Figure 3</xref>(e)), cytoskeleton and the stress response were the most represented categories, and proteins involved in the stress response were significantly more likely to be documented at higher levels by corals of HBH (22% of the differentially expressed proteome) than conspecifics of HWN (<xref ref-type="fig" rid="fig3">Figure 3</xref>(f); 3%; 2-sample proportion test, P &lt; 0.05). For the 35 HWN &gt; HBH DCPs (<xref ref-type="fig" rid="fig3">Figure 3</xref>(f)), proteins involved in transcription and transport were instead of higher proportional abundance.</p></sec><sec id="s3_6"><title>3.6. Host Coral and Symbiodinium Differentially Concentrated Proteomes</title><p>When looking only at the 29 host coral DCPs (<xref ref-type="fig" rid="fig3">Figure 3</xref>(g)), proteins involved in the stress response, cytoskeleton, and transcription were most abundant. As when the host and Symbiodinium data were pooled (<xref ref-type="fig" rid="fig3">Figure 3</xref>(d)-(f); discussed above), the former process was proportionally more abundant in the HBH &gt; HWN proteome (<xref ref-type="fig" rid="fig3">Figure 3</xref>(h)); 22% of the 9 HBH &gt; HWN and 0% of the 20 HWN &gt; HWN host DCPs were involved in the stress response (<xref ref-type="fig" rid="fig3">Figure 3</xref>(i); 2-sample proportion test, P &lt; 0.05). Instead, transport and transcription were</p><p>the most numerically dominant functional categories in the HWN &gt; HBH differentially concentrated host coral proteome (<xref ref-type="fig" rid="fig3">Figure 3</xref>(i)).</p><table-wrap-group id="2"><label><xref ref-type="table" rid="table">Table </xref>2</label><caption><title> The 38 proteins whose concentrations were higher in corals of the non-upwelling control site: Houwan (HWN). Spots 1, 2, 3, 4, 5, and 6 in the left-most column correspond to spots “HW1,” “HW2,” “HW3,” “HW4,” “HW5,” and “HW6,” respectively, in <xref ref-type="fig" rid="fig2">Figure 2</xref>(a); all were found only in the three HWN gels (and therefore in none of the three Houbihu [HBH] gels). The average coverage of 15 &#177; 13% (std. dev.) did not differ significantly from that of the 15 differentially concentrated proteins found within the 3 HBH &gt; HWN spots (14 &#177; 9% [std. dev.]; <xref ref-type="table" rid="table">Table </xref>3; student’s t-test, P &gt; 0.05). Contigs denoted by asterisks were associated with congruency between mRNA expression and protein concentration. The host/Symbiodinium (Sym) ratio of 20/15 (1.3:1) did not differ significantly from the HBH &gt; HWN ratio of 9/5 (1.8:1; <xref ref-type="table" rid="table">Table </xref>3; 2-sample proportion test, P &gt; 0.05), nor did it differ from the Seriatopora hystrix/Sym mRNA ratio of 1.8:1 [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] (z-test, P &gt; 0.05). For the peptide sequences, please see <xref ref-type="table" rid="table">Table </xref>S1</title></caption><table-wrap id="2_1"><table><tbody><thead><tr><th align="center" valign="middle" >Spot (s)</th><th align="center" valign="middle" >Compartment</th><th align="center" valign="middle" >Contig</th><th align="center" valign="middle" >Identity</th><th align="center" valign="middle" >Functional category</th><th align="center" valign="middle" >Coverage (%)</th></tr></thead><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c71519_g1</td><td align="center" valign="middle" >putative transcription factor Ovo-like 1</td><td align="center" valign="middle" >transcription</td><td align="center" valign="middle" >13</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c32821_g1</td><td align="center" valign="middle" >leucine-rich repeat &amp; IQ domain-containing protein 1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >9</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c79274_g3</td><td align="center" valign="middle" >von Willebrand factor D &amp; EGF domain-containing protein</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >8</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c146943_g1</td><td align="center" valign="middle" >ubiquitin-40S ribosomal protein S27a</td><td align="center" valign="middle" >stress response</td><td align="center" valign="middle" >35</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c30229_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >25</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c288_g1</td><td align="center" valign="middle" >adenylate cyclase</td><td align="center" valign="middle" >metabolism</td><td align="center" valign="middle" >6</td></tr><tr><td align="center" valign="middle" >2</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c73482_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >16</td></tr><tr><td align="center" valign="middle" >2</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c63186_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >12</td></tr><tr><td align="center" valign="middle" >2</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c69424_g1*</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >12</td></tr><tr><td align="center" valign="middle" >2,5</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c79716_g1</td><td align="center" valign="middle" >debrin-like</td><td align="center" valign="middle" >cell migration/ actin binding</td><td align="center" valign="middle" >8</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c86107_g1<sup>a</sup></td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >19</td></tr><tr><td align="center" valign="middle" >3-5</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c65959_g1</td><td align="center" valign="middle" >Rho GDP-dissociation inhibitor 1</td><td align="center" valign="middle" >cytoskeleton</td><td align="center" valign="middle" >16</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c69652_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >8</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c76783_g1<sup>a</sup></td><td align="center" valign="middle" >serine/arginine repetitive matrix protein 2</td><td align="center" valign="middle" >RNA processing</td><td align="center" valign="middle" >7</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c80461_g1</td><td align="center" valign="middle" >voltage-dependent R-type calcium channel subunit alpha-1E-like isoform X2</td><td align="center" valign="middle" >transport</td><td align="center" valign="middle" >1</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c75440_g1<sup>b</sup></td><td align="center" valign="middle" >fucoxanthin-chlorophyll a-c binding protein</td><td align="center" valign="middle" >photosynthesis</td><td align="center" valign="middle" >24</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c28876_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >17</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c192890_g1</td><td align="center" valign="middle" >bestrophin/alpha-ketoglutarate-dependent dioxygenase alkB-like</td><td align="center" valign="middle" >transport</td><td align="center" valign="middle" >16</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c147855_g1</td><td align="center" valign="middle" >hippocalcin-like protein 1</td><td align="center" valign="middle" >transport</td><td align="center" valign="middle" >13</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c117310_g1</td><td align="center" valign="middle" >alpha-1,2-mannosyltransferase ALG9</td><td align="center" valign="middle" >metabolism</td><td align="center" valign="middle" >6</td></tr><tr><td align="center" valign="middle" >4</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c62634_g1</td><td align="center" valign="middle" >protamine</td><td align="center" valign="middle" >DNA stabilization</td><td align="center" valign="middle" >14</td></tr><tr><td align="center" valign="middle" >4</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c80550_g3</td><td align="center" valign="middle" >Prolow-density lipoprotein receptor-related protein 1</td><td align="center" valign="middle" >endocytosis</td><td align="center" valign="middle" >3</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c167493_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >63</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c168524_g1</td><td align="center" valign="middle" >short-chain collagen C4</td><td align="center" valign="middle" >structural</td><td align="center" valign="middle" >22</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c170150_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >16</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c77868_g2<sup>a</sup></td><td align="center" valign="middle" >eukaryotic translation initiation factor 3 subunit A-like</td><td align="center" valign="middle" >translation</td><td align="center" valign="middle" >12</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c72431_g1</td><td align="center" valign="middle" >Schlafen family member 5</td><td align="center" valign="middle" >cell differentiation</td><td align="center" valign="middle" >3</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c51777_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >14</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c97047_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >10</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c13654_g1*</td><td align="center" valign="middle" >ankyrin repeat domain-containing protein 50</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >4</td></tr></tbody></table></table-wrap><table-wrap id="2_2"><table><tbody><thead><tr><th align="center" valign="middle" >Spot (s)</th><th align="center" valign="middle" >Compartment</th><th align="center" valign="middle" >Contig</th><th align="center" valign="middle" >Identity</th><th align="center" valign="middle" >Functional category</th><th align="center" valign="middle" >Coverage (%)</th></tr></thead><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c52097_g1</td><td align="center" valign="middle" >DEAD-box ATP-dependent RNA helicase 35</td><td align="center" valign="middle" >RNA processing</td><td align="center" valign="middle" >3</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >c46638_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >51</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >c45226_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >33</td></tr><tr><td align="center" valign="middle" >5</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >c41865_g1*</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >18</td></tr><tr><td align="center" valign="middle" >6</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c52240_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >14</td></tr><tr><td align="center" valign="middle" >6</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c29807_g1</td><td align="center" valign="middle" >serine/threonine protein kinase pelle</td><td align="center" valign="middle" >signal transduction</td><td align="center" valign="middle" >3</td></tr><tr><td align="center" valign="middle" >6</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c37817_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >3</td></tr><tr><td align="center" valign="middle" >6</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c48738_g1</td><td align="center" valign="middle" >DNA topoisomerase I</td><td align="center" valign="middle" >DNA replication</td><td align="center" valign="middle" >3</td></tr></tbody></table></table-wrap></table-wrap-group><p><sup>a</sup>Maintained at lower concentrations in corals exposed to variable temperature regimes [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] ; <sup>b</sup>Closely related to a protein documented at lower concentrations in corals exposed to variable temperature regimes [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] .</p><table-wrap id="table3" ><label><xref ref-type="table" rid="table">Table </xref>3</label><caption><title> The 15 proteins whose concentrations were higher in corals of the upwelling site: Houbihu (HBH). Spots 1, 2, and 3 in the left-most column correspond to spots “HB1,” “HB2,” and “HB3,” respectively, in <xref ref-type="fig" rid="fig2">Figure 2</xref>(b). Only the latter spot was unique to the HBH gels; spots HB1 and HB2 were concentrated at higher levels in the HBH gels than the HWN gels and so were differentially concentrated proteins (DCPs) rather than uniquely synthesized proteins (USPs). Contigs denoted by asterisks were associated with congruency between mRNA expression and protein concentration. The host/Symbiodinium (Sym) DCP + USP ratio of 9/5 (1.8:1) was the same as the Seriatopora hystrix/Sym mRNA ratio [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] (1.8:1; z-test, P &gt; 0.05). For the peptide sequences, please see <xref ref-type="table" rid="table">Table </xref>S1</title></caption><table><tbody><thead><tr><th align="center" valign="middle" >Spot</th><th align="center" valign="middle" >Compartment</th><th align="center" valign="middle" >Contig</th><th align="center" valign="middle" >Identity</th><th align="center" valign="middle" >Functional category</th><th align="center" valign="middle" >Coverage (%)</th></tr></thead><tr><td align="center" valign="middle" >1 (DCP)</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c69816_g1</td><td align="center" valign="middle" >actin</td><td align="center" valign="middle" >cytoskeleton</td><td align="center" valign="middle" >27</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c41229_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >22</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c58883_g1*</td><td align="center" valign="middle" >O-aminophenol oxidase</td><td align="center" valign="middle" >stress response</td><td align="center" valign="middle" >11</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c80336_g3</td><td align="center" valign="middle" >RIMS-binding protein</td><td align="center" valign="middle" >neurotransmission</td><td align="center" valign="middle" >9</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c76524_g1</td><td align="center" valign="middle" >RNA polymerase-associated protein CTR9-like</td><td align="center" valign="middle" >RNA processing/editing</td><td align="center" valign="middle" >4</td></tr><tr><td align="center" valign="middle" >1</td><td align="center" valign="middle" >intermediate</td><td align="center" valign="middle" >c36639_g1</td><td align="center" valign="middle" >RNA recognition motif (RRM) superfamily</td><td align="center" valign="middle" >RNA processing/editing</td><td align="center" valign="middle" >8</td></tr><tr><td align="center" valign="middle" >2 (DCP)</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c64389_g2</td><td align="center" valign="middle" >gelsolin-like</td><td align="center" valign="middle" >cytoskeleton</td><td align="center" valign="middle" >27</td></tr><tr><td align="center" valign="middle" >2</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c59669_g2</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >10</td></tr><tr><td align="center" valign="middle" >2</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c103934_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >15</td></tr><tr><td align="center" valign="middle" >2</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c185341_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >13</td></tr><tr><td align="center" valign="middle" >2</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c61072_g1</td><td align="center" valign="middle" >HSPB1-associated protein 1-like</td><td align="center" valign="middle" >stress response</td><td align="center" valign="middle" >10</td></tr><tr><td align="center" valign="middle" >3 (USP)</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c62707_g1<sup>a</sup></td><td align="center" valign="middle" >beta-gamma crystallin</td><td align="center" valign="middle" >stress response</td><td align="center" valign="middle" >34</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >host</td><td align="center" valign="middle" >c108872_g1</td><td align="center" valign="middle" >protein split ends isoform X1</td><td align="center" valign="middle" >transcriptional repression</td><td align="center" valign="middle" >12</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c31796_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >21</td></tr><tr><td align="center" valign="middle" >3</td><td align="center" valign="middle" >Sym</td><td align="center" valign="middle" >c37656_g1</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >unknown</td><td align="center" valign="middle" >4</td></tr></tbody></table></table-wrap><p><sup>a</sup>Maintained at lower concentrations in corals exposed to variable temperature regimes [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] .</p><p>In general, the same functional categories differed in proportional abundance between sites of origin for Symbiodinium (<xref ref-type="fig" rid="fig3">Figure 3</xref>(j)): stress response, transcription, and transport. However, the Symbiodinium differentially concentrated proteome also featured proteins involved in metabolism. When compared to another study performed with Taiwanese S. hystrix samples [<xref ref-type="bibr" rid="scirp.83045-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] , the Symbiodinium proteome sequenced herein featured significantly higher proportions of proteins involved in the stress response, transport, and transcription (2-sample proportion tests, P &lt; 0.05). In the stable vs. variable temperature experiment, on the other hand, proteins associated with lipid bodies and mRNA processing were more likely to be maintained at different levels by Symbiodinium populations (2-sample proportion tests, P &lt; 0.05).</p><p>Only five Symbiodinium proteins were identified across the three HBH &gt; HWN protein spots, and only one could be identified with confidence (<xref ref-type="fig" rid="fig3">Figure 3</xref>(k)): a stress-associated HSPB1-associated protein 1-like protein was concentrated at higher levels in Symbiodinium from corals of HBH (<xref ref-type="table" rid="table">Table </xref>3). In contrast, the majority of the 15 HWN &gt; HBH Symbiodinium DCPs could be identified with confidence (<xref ref-type="fig" rid="fig3">Figure 3</xref>(l)), and these proteins were involved in metabolism, transport, and transcription. No functional category differed in proportional abundance between host and Symbiodinium for the HBH &gt; HWN or HWN &gt; HBH differentially expressed proteomes.</p></sec><sec id="s3_7"><title>3.7. Congruency between mRNA Expression and Protein Concentration</title><p>The congruency between mRNA and protein expression did not differ between the two compartments of the S. hystrix-Symbiodinium endosymbiosis (2-sample proportion tests, P &gt; 0.05). Specifically, 2 of the 29 host coral molecules (7%) and 1 of the 20 Symbiodinium molecules (5%) demonstrated congruency between mRNA expression and protein concentration. These three molecules included 1) a host O-aminophenol oxidase involved in the oxidative stress response (the lone HBH &gt; HWN molecule demonstrating congruency between mRNA and protein expression; 7%; <xref ref-type="table" rid="table">Table </xref>3), 2) one host coral molecule of unknown function (HWN &gt; HBH; <xref ref-type="table" rid="table">Table </xref>2), and 3) one Symbiodinium molecule of unknown function (HWN &gt; HBH; <xref ref-type="table" rid="table">Table </xref>2). In addition, one HWN &gt; HBH USP of unknown cellular origin (<xref ref-type="table" rid="table">Table </xref>2) also demonstrated congruency between mRNA expression and protein concentration. The overall mRNA vs. protein congruency of 7.5% (4/53) was significantly higher than that of another study performed with Taiwanese S. hystrix samples (2-sample proportion test, P &lt; 0.05); Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] found only 2 molecules out of 167 total (&lt;2%) that demonstrated congruency between mRNA expression and protein concentration. A more detailed comparison with this only other proteomic assessment of S. hystrix [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] can be found below.</p></sec><sec id="s3_8"><title>3.8. Comparison with a Stable vs. Variable Temperature Regime Study Carried out with S. hystrix</title><p>Besides a host coral beta-gamma crystallin protein, only three additional proteins were found to be differentially concentrated between sites of origin herein and between stable and variable temperature treatments in S. hystrix nubbins made from these same colonies by Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] . All three proteins were of host coral origin, though only two could be identified with confidence: a serine-arginine repetitive matrix protein (RMP) involved in mRNA processing and a translation factor known as eukaryotic translation initiation factor 3 subunit A-like. The serine-arginine RMP was one of only four DCPs uncovered herein involved in mRNA processing and editing (7.5%), the most temperature-sensitive cellular process documented previously in S. hystrix [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] (16%). In contrast to the variable temperature study, proteins whose concentrations differed between the two study sites herein were more likely to be involved in the stress response, transcription, transport, and the cytoskeleton.</p></sec></sec><sec id="s4"><title>4. Discussion</title><sec id="s4_1"><title>4.1. The Environmental Physiology of S. hystrix in Southern Taiwan</title><p>Cell and molecular biology-driven approaches have aided in developing our understanding of both the fundamental biology of anthozoan-dinoflagellate endosymbioses [<xref ref-type="bibr" rid="scirp.83045-ref31">31</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref32">32</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref33">33</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref34">34</xref>] , as well as their environmental physiology [<xref ref-type="bibr" rid="scirp.83045-ref35">35</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref36">36</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref37">37</xref>] . Herein we utilized a differential proteomics approach to uncover proteins whose concentrations differed between corals of an upwelling site (HBH) and a non-upwelling site (HWN). In addition to the difference in the mean monthly temperature range between these two sites uncovered in prior works (e.g., [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] ), a meta-analysis of previously published data conducted herein also revealed significant differences in silicate concentrations, suspended solid levels, and turbidity between them; specifically, these parameters were all significantly higher at HBH. As the PAR levels reaching the sampled corals were identical at each site, the elevated turbidity and suspended solid levels at HBH did not evidently result in a decrease in PAR reaching the sampled S. hystrix colonies. However, it is possible that such suspended solids affected other wavelengths of light that were not measured; for instance, high levels of suspended particulate matter lead to the attenuation of ultraviolet radiation (UVR) in wastewater [<xref ref-type="bibr" rid="scirp.83045-ref38">38</xref>] .</p><p>If diminished UVR levels were reaching the HBH S. hystrix colonies, then they could be hypothesized to be at lower risk of high temperature + UVR-induced bleaching [<xref ref-type="bibr" rid="scirp.83045-ref39">39</xref>] . In fact, relatively more proteins in the HBH&gt;HWN differentially expressed host + Symbiodinium proteome (22%) were involved in the stress response compared to the 35-protein HWN &gt; HBH proteome (3%). These three, presumably stress-targeted HBH &gt; HWN proteins included two host coral proteins, beta-gamma crystallin and O-aminophenol oxidase, as well as the Symbiodinium protein known as HSPB1-associated protein 1-like. Beta-gamma crystallin, which has only ever been hypothesized to be involved in the stress response (as well as calcium binding [<xref ref-type="bibr" rid="scirp.83045-ref40">40</xref>] ), was actually found to be down-regulated in S. hystrix specimens exposed to a variable temperature regime for one week [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] and represents one of only four proteins found to differ in concentration between sites of origin herein and across temperature treatments in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] ; as such, and in reiterating the recommendation of Meyer et al. [<xref ref-type="bibr" rid="scirp.83045-ref41">41</xref>] , we advocate that the role of beta-gamma crystallin in coral thermal adaptation be more thoroughly characterized in future works.</p><p>Given the fact that mean monthly temperature range, silicate concentrations, and suspended solid levels and turbidity were all higher at HBH (the upwelling site), it is tempting to speculate that the relatively higher number of stress response-associated proteins within the HBH &gt; HWN proteome is indicative of sub-lethal levels of cellular stress in corals of HBH. However, the physiological performance of these corals did not differ from those of HWN ( [<xref ref-type="bibr" rid="scirp.83045-ref12">12</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref15">15</xref>] and <xref ref-type="table" rid="table1"><xref ref-type="table" rid="table">Table </xref>1</xref>). This may mean, in contrast, that such constitutively elevated stress protein levels instead represent “front-loading” [<xref ref-type="bibr" rid="scirp.83045-ref25">25</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref42">42</xref>] , whereby stress proteins are maintained at high intracellular concentrations such that the molecular machinery requisite for dealing with large shifts in the abiotic environment (e.g., an upwelling event in the case of corals of HBH) is engaged at any given time. This strategy is relatively uncommon in nature given the high energetic expense of being constitutively “stressed” at all times [<xref ref-type="bibr" rid="scirp.83045-ref43">43</xref>] , though it does characterize the cellular biology of some intertidal invertebrates [<xref ref-type="bibr" rid="scirp.83045-ref44">44</xref>] . By exposing corals from both study sites to variable temperature regimes and elevated suspended solid levels in the laboratory, it may ultimately be determined whether the protein expression signatures of corals of HBH documented herein are resultant of cellular stress due to, for instance, direct impacts of sediments with coral tissues (sensu [<xref ref-type="bibr" rid="scirp.83045-ref45">45</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref46">46</xref>] ), or, alternatively, represent a protective response to counter future environmental change. If healthy corals indeed constitutively maintain high cellular concentrations of stress-associated proteins, as has also been documented in the most-remote reaches of French Polynesia [<xref ref-type="bibr" rid="scirp.83045-ref35">35</xref>] , then this may complicate the interpretation of data derived from molecular biomarker panels aimed at assessing coral health; in other words, are high concentrations of molecular chaperones and other stress proteins indicative of healthy corals or stressed ones?</p></sec><sec id="s4_2"><title>4.2. The Role of Osmoregulation in Coral Acclima(tiza)tion to Environmental Change</title><p>Osmoregulation has been hypothesized to be the crux of the coral stress and bleaching response [<xref ref-type="bibr" rid="scirp.83045-ref47">47</xref>] . This theory stems from the fact that high temperature- and light-induced photoinhibition [<xref ref-type="bibr" rid="scirp.83045-ref48">48</xref>] would presumably result in a reduction in osmolyte flux from Symbiodinium to host. This would lead to a drop in osmotic pressure in the endosymbiotic gastrodermal cell [<xref ref-type="bibr" rid="scirp.83045-ref49">49</xref>] , which would manifest in changes in cytoskeletal architecture [<xref ref-type="bibr" rid="scirp.83045-ref50">50</xref>] . This may explain why a large number of host cytoskeleton-associated proteins were differentially concentrated between corals of the two sites. Specifically, actin and gelsolin (which is involved in actin assembly/disassembly) were synthesized at higher levels by corals of HBH. The fact that these corals are more likely to undergo osmotic pressure fluctuations as a result of upwelling-induced temperature changes may explain why they constitutively synthesize larger quantities of gelsolin, in particular, as this protein acts in cytoskeleton rebuilding. Not surprisingly then, genes encoding proteins involved in the cytoskeleton have found to be differentially expressed in corals exposed to elevated temperatures [<xref ref-type="bibr" rid="scirp.83045-ref51">51</xref>] . Given these findings, as well as the fact that osmoregulation is the most energetically expensive task a cell undertakes, the role of osmoregulation in the coral thermal stress response should be more thoroughly characterized in future works. It should be noted here that, due to the rigid cell walls of Symbiodinium, the osmotic stress associated with temperature + UVR stress-derived photoinhibition mentioned above is not hypothesized to dramatically affect Symbiodinium cell volume [<xref ref-type="bibr" rid="scirp.83045-ref47">47</xref>] ; therefore, it is unsurprising that no Symbiodinium cytoskeleton proteins were uncovered herein.</p></sec><sec id="s4_3"><title>4.3. Congruency between mRNA Expression and Protein Concentration</title><p>Unfortunately, it has become commonplace in the coral biology field to make conjectures about protein behavior based on mRNA expression data alone (sensu [<xref ref-type="bibr" rid="scirp.83045-ref52">52</xref>] [<xref ref-type="bibr" rid="scirp.83045-ref53">53</xref>] ), despite the fact that mRNA vs. protein congruency has been found to be as low as 0% in Symbiodinium populations within S. hystrix nubbins of another study [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] . Likewise, the degree of congruency between mRNA expression and protein concentration was markedly low herein; only 4 of the 53 DCPs uncovered were associated with an mRNA whose expression also differed significantly between sites of origin (7.5%). One such molecule, the host coral O-aminophenol oxidase, was discussed above in the context of the coral stress/environmental acclimation response. Given the low congruency between mRNA expression and protein concentration in both this study (7.5%) and others (2% in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref17">17</xref>] and 10.5% in Mayfield et al. [<xref ref-type="bibr" rid="scirp.83045-ref26">26</xref>] ), we advise that those researchers looking to model the response of anthozoan-dinoflagellate endosymbioses to environmental change instead exploit proteomics-based approaches in their experiments; unlike the mRNAs that encode them, proteins actually enact physiological changes in cells and are likely to play key roles in thermal acclimation in both coral hosts [<xref ref-type="bibr" rid="scirp.83045-ref54">54</xref>] and their in hospite Symbiodinium populations.</p></sec></sec><sec id="s5"><title>Acknowledgements</title><p>The authors would like to thank Dr. Yu-Bin Wang for developing the MS-SCAN software and implementing it on the S. hystrix-Symbiodinium transcriptome server, as well as Drs. Peter Edmunds and Tung-Yung Fan for fruitful discussions on the eco-physiology of corals of Southern Taiwan. This work was funded by the United States National Science Foundation (postdoctoral research fellowship to ABM; OISE-0852960) and the Khaled bin Sultan Living Oceans Foundation (postdoctoral research fellowship to ABM).</p></sec><sec id="s6"><title>Cite this paper</title><p>Mayfield, A.B., Chen, Y.-J., Lu, C.-Y. and Chen, C.-S. (2018) Exploring the Environmental Physiology of the Indo-Pacific Reef Coral Seriatopora hystrix with Differential Proteomics. Open Journal of Marine Science, 8, 223-252. https://doi.org/10.4236/ojms.2018.82012</p></sec><sec id="s7"><title>Supplemental Data-Peptide Sequences</title><table-wrap-group id="4"><label><xref ref-type="table" rid="table">Table </xref>S1</label><caption><title> “AA” = amino acids. “Sym” = Symbiodinium. * = two peptide sequences overlapped. ** = three peptide sequences overlapped</title></caption><table-wrap id="4_1"><table><tbody><thead><tr><th align="center" valign="middle" >Name</th><th align="center" valign="middle" >Length (#AA)</th><th align="center" valign="middle" >Sequence</th><th align="center" valign="middle" >Protein identity</th></tr></thead><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 1 (c41229_g1)</td><td align="center" valign="middle" >39</td><td align="center" valign="middle" >AIYEMKKKLGVNIKFIHVVRNPFDNIATMVLQHKAIKGR*</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 2 (c58883_g1)</td><td align="center" valign="middle" >30</td><td align="center" valign="middle" >QLRRLGVKKKERRHARKLLKKELEPKKRIR*</td><td align="center" valign="middle" >host O-aminophenol oxidase</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 3, peptide 1 (c69816_g1)</td><td align="center" valign="middle" >21</td><td align="center" valign="middle" >AGFAGDDAPRAVFPSIVGRPR*</td><td align="center" valign="middle" >host actin</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 3, peptide 2 (c69816_g1)</td><td align="center" valign="middle" >12</td><td align="center" valign="middle" >DSYVGDEAQSKR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 3, peptide 3 (c69816_g1)</td><td align="center" valign="middle" >29</td><td align="center" valign="middle" >IWHHTFYNELRVAPEEHPVLLTEAPLNPK*</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 3, peptide 4 (c69816_g1)</td><td align="center" valign="middle" >10</td><td align="center" valign="middle" >GYSFTTTAER</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 3, peptide 5 (c69816_g1)</td><td align="center" valign="middle" >16</td><td align="center" valign="middle" >SYELPDGQVITIGNER</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 3, peptide 6 (c69816_g1)</td><td align="center" valign="middle" >13</td><td align="center" valign="middle" >QEYDESGPSIVHR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 4, peptide 1 (c80336_g3)</td><td align="center" valign="middle" >18</td><td align="center" valign="middle" >QRAKDLAEHAKALLSKEK</td><td align="center" valign="middle" >host RIMS-binding protein</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 4, peptide 2 (c80336_g3)</td><td align="center" valign="middle" >19</td><td align="center" valign="middle" >LEVSDVKCGLLTDECNKLK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 5, peptide 1 (c36639_g1)</td><td align="center" valign="middle" >22</td><td align="center" valign="middle" >GHQHWDNNYWRKDDRRPSRYWR</td><td align="center" valign="middle"  rowspan="2"  >RNA recognition motif superfamily<sup>a</sup></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 5, peptide 2 (c36639_g1)</td><td align="center" valign="middle" >24</td><td align="center" valign="middle" >QKRRRRRKMDETGQPQRHLKRRKR</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 6, peptide 1 (c76524_g1)</td><td align="center" valign="middle" >32</td><td align="center" valign="middle" >FFKHHNVEVLLYLARAYFKAGKLKECKQILLK</td><td align="center" valign="middle"  rowspan="2"  >host RNA polymerase-associated protein CTR9-like</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 1, protein 6, peptide 2 (c76524_g1)</td><td align="center" valign="middle" >29</td><td align="center" valign="middle" >TFVKKVPKTDKSDPKRLKKDLPKILKTLK</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 1 (c64389_g2)</td><td align="center" valign="middle" >13</td><td align="center" valign="middle" >DSNLALFGSDLEK</td><td align="center" valign="middle" >host gelsolin-like</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 2 (c64389_g2)</td><td align="center" valign="middle" >14</td><td align="center" valign="middle" >FYNGDSYIILNTYK</td><td align="center" valign="middle" ></td></tr></tbody></table></table-wrap><table-wrap id="4_2"><table><tbody><thead><tr><th align="center" valign="middle" >Name</th><th align="center" valign="middle" >Length (#AA)</th><th align="center" valign="middle" >Sequence</th><th align="center" valign="middle" >Protein identity</th></tr></thead><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 3 (c64389_g2)</td><td align="center" valign="middle" >28</td><td align="center" valign="middle" >ESTQDEYGTAAYKTVELDTLNDKPVQHR*</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 4 (c64389_g2)</td><td align="center" valign="middle" >18</td><td align="center" valign="middle" >KYFSQLELLTGGADSGFR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 5 (c64389_g2)</td><td align="center" valign="middle" >38</td><td align="center" valign="middle" >VTEVAYCKESITPDNVYVIDNGEEIYQINGSSSDKDER*</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 6 (c64389_g2)</td><td align="center" valign="middle" >9</td><td align="center" valign="middle" >AAQYCQSLK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 7 (c64389_g2)</td><td align="center" valign="middle" >46</td><td align="center" valign="middle" >EGGFGGLPSGDPDTEDPIDDDFEPTIKKISDASGHLELSDTSGFSK*</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 8 (c64389_g2)</td><td align="center" valign="middle" >9</td><td align="center" valign="middle" >DVFIVDNGK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 1, peptide 9 (c64389_g2)</td><td align="center" valign="middle" >10</td><td align="center" valign="middle" >HPLVPVSVVK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 2 (c103934_g1)</td><td align="center" valign="middle" >39</td><td align="center" valign="middle" >LEKLEKLARKAAEKMQKKKDKKGKKDKKKDKKSKKDKKK*</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 3 (c185341_g1)</td><td align="center" valign="middle" >39</td><td align="center" valign="middle" >DDRDRDRGHDRERSFEERRPRDDRDGRYRDDRDGRDRGR*</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 4 (c61072_g1)</td><td align="center" valign="middle" >46</td><td align="center" valign="middle" >VRQVPSGLTQPCTLVPKRGHEPVWRHWNISFWKEACGLEYCNCRSR*</td><td align="center" valign="middle" >Sym HSPB1-associated protein 1-like</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 5, peptide 1 (c59669_g2)</td><td align="center" valign="middle" >19</td><td align="center" valign="middle" >DEEDEEASKEDEEKEDEAK</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 2, protein 5, peptide 2 (c59669_g2)</td><td align="center" valign="middle" >19</td><td align="center" valign="middle" >CQWPCMWPCCCECDPPKFK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 1, peptide 1 (c31796_g1)</td><td align="center" valign="middle" >35</td><td align="center" valign="middle" >ADTAASESEGAKYDEPDTETEDEADKHRRLPMHGR</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 1, peptide 2 (c31796_g1)</td><td align="center" valign="middle" >28</td><td align="center" valign="middle" >SKVKAKAKAKAKAKAKAKPKAKAKAKAK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 2, peptide 1 (c108872_g1)</td><td align="center" valign="middle" >18</td><td align="center" valign="middle" >THRERQRQDEELREQKER</td><td align="center" valign="middle" >host protein split ends isoform X1</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 2, peptide 2 (c108872_g1)</td><td align="center" valign="middle" >22</td><td align="center" valign="middle" >EKERKEKEQREREAREREQRER</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 3, peptide 1 (c62707_g1)</td><td align="center" valign="middle" >16</td><td align="center" valign="middle" >NGLGEEFTGSDANLKK</td><td align="center" valign="middle" >host beta-gamma crystallin</td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 3, peptide 2 (c62707_g1)</td><td align="center" valign="middle" >9</td><td align="center" valign="middle" >HGFYGGFSK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 3, peptide 3 (c62707_g1)</td><td align="center" valign="middle" >35</td><td align="center" valign="middle" >GAGVSSAIVLSKNENFAIFTETNYKGIE QQLDAGK**</td><td align="center" valign="middle" ></td></tr></tbody></table></table-wrap><table-wrap id="4_3"><table><tbody><thead><tr><th align="center" valign="middle" >Name</th><th align="center" valign="middle" >Length (#AA)</th><th align="center" valign="middle" >Sequence</th><th align="center" valign="middle" >Protein identity</th></tr></thead><tr><td align="center" valign="middle" >HBH &gt; HWN spot 3, protein 4 (c37656_g1)</td><td align="center" valign="middle" >18</td><td align="center" valign="middle" >DRSKAALDTKAEPKDRSK</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 1 (c146943_g1)</td><td align="center" valign="middle" >26</td><td align="center" valign="middle" >KKTYTKPKKIKHKRKKVKLAVLKFYK*</td><td align="center" valign="middle" >Sym ubiquitin-40S ribosomal protein S27a</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 2 (c30229_g1)</td><td align="center" valign="middle" >31</td><td align="center" valign="middle" >KKEKAVKKKDKKKDKKDKKKKKD KKGKKKKK**</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 3, peptide 1 (c71519_g1)</td><td align="center" valign="middle" >18</td><td align="center" valign="middle" >KTFRPKLTSENQMECFKK</td><td align="center" valign="middle"  rowspan="2"  >host putative transcription factor Ovo-like 1</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 3, peptide 2 (c71519_g1)</td><td align="center" valign="middle" >32</td><td align="center" valign="middle" >DNQSEFMTHMANVHPDREKGPW MNKNTNLCAR</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 4, peptide 1 (c32821_g1)</td><td align="center" valign="middle" >33</td><td align="center" valign="middle" >TRKEFQPLLEAKKLERVKKRNEELDRIERVERK</td><td align="center" valign="middle"  rowspan="2"  >host leucine-rich repeat and IQ domain-containing protein 1</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 4, peptide 2 (c32821_g1)</td><td align="center" valign="middle" >15</td><td align="center" valign="middle" >KKEEEKRTREEIQRK</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 5, peptide 1 (c79274_g3)</td><td align="center" valign="middle" >21</td><td align="center" valign="middle" >CECYENYHSPETGCDRSFCAK</td><td align="center" valign="middle"  rowspan="2"  >host von Willebrand factor D and EGF domain-containing protein</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 5, peptide 2 (c79274_g3)</td><td align="center" valign="middle" >26</td><td align="center" valign="middle" >KCHCDEGWDNQIHVSGFNAHFGPCKK</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 6, peptide 1 (c288_g1)</td><td align="center" valign="middle" >25</td><td align="center" valign="middle" >AARMSRVGTKAGRVVRLLRLVRLIR</td><td align="center" valign="middle" >Sym adenylate cyclase</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 1, protein 6, peptide 2 (c288_g1)</td><td align="center" valign="middle" >32</td><td align="center" valign="middle" >RGQQRDPDAESDAKRNCCSRCCSATLKCIRRR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 2, protein 1 (c63186_g1)</td><td align="center" valign="middle" >29</td><td align="center" valign="middle" >KTVKMIEKQLALKKLKKKSKISKKHPKKK*</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 2, protein 2, peptide 1 (c69424_g1)</td><td align="center" valign="middle" >20</td><td align="center" valign="middle" >DIDYGCMEGSCAMEYCQHTK</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 2, protein 2, peptide 2 (c69424_g1)</td><td align="center" valign="middle" >26</td><td align="center" valign="middle" >CGQKEDCRKAAESWGNCKAFSCFANR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 2, protein 3, peptide 1 (c73482_g1)</td><td align="center" valign="middle" >20</td><td align="center" valign="middle" >CRNWSQCKKDECCIRYSVNK</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 2, protein 3, peptide 2 (c73482_g1)</td><td align="center" valign="middle" >15</td><td align="center" valign="middle" >TTKWGQKKHRCERLR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 2, protein 4 (c79716_g1)</td><td align="center" valign="middle" >41</td><td align="center" valign="middle" >RLADERKMLEEEEMQRQIDMERRRKEEEERRKRDTEERRKR*</td><td align="center" valign="middle" >host debrin-like</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 1 (c117310_g1)</td><td align="center" valign="middle" >36</td><td align="center" valign="middle" >EERKRQRHEAIWKEWKKLLRSLVVYVKFRLPLRKTR*</td><td align="center" valign="middle" >Sym alpha-1,2-mannosyltransferase ALG9</td></tr></tbody></table></table-wrap><table-wrap id="4_4"><table><tbody><thead><tr><th align="center" valign="middle" >Name</th><th align="center" valign="middle" >Length (#AA)</th><th align="center" valign="middle" >Sequence</th><th align="center" valign="middle" >Protein identity</th></tr></thead><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 2, peptide 1 (c147855_g1)</td><td align="center" valign="middle" >21</td><td align="center" valign="middle" >EHPLILAWQALFNGYWNTKSR</td><td align="center" valign="middle" >Sym hippocalcin-like protein 1</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 2, peptide 2 (c147855_g1)</td><td align="center" valign="middle" >15</td><td align="center" valign="middle" >WRGKTDNSWLEYVKK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 3, peptide 1 (c192890_g1)</td><td align="center" valign="middle" >22</td><td align="center" valign="middle" >MSLLQHWRCSLRSHVRFLRTSR</td><td align="center" valign="middle"  rowspan="2"  >Sym bestrophin/ alpha-ketoglutarate-dependent dioxygenase AlkB-like</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 3, peptide 2 (c192890_g1)</td><td align="center" valign="middle" >38</td><td align="center" valign="middle" >INCCFDAIFTTVHRGQMLGVYSSEL ASGMYELASNMFR</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 4, peptide 1 (c28876_g1)</td><td align="center" valign="middle" >16</td><td align="center" valign="middle" >DRSRSPHRSPRRSPRR</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 4, peptide 2 (c28876_g1)</td><td align="center" valign="middle" >22</td><td align="center" valign="middle" >DDRWKDRNDRNDRSDRSDRNDR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 5, peptide 1 (c65959_g1)</td><td align="center" valign="middle" >17</td><td align="center" valign="middle" >TLDEIQKLDAEDESLVR**</td><td align="center" valign="middle" >host Rho GDP-dissociation inhibitor 1</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 5, peptide 2 (c65959_g1)</td><td align="center" valign="middle" >15</td><td align="center" valign="middle" >AGPQEYLTPLDEAPK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 6, peptide 1 (c69652_g1)</td><td align="center" valign="middle" >38</td><td align="center" valign="middle" >KENKSKPNHAAKSKVAKKKKLKVKGTPLTSLSKTVTYK</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 6, peptide 2 (c69652_g1)</td><td align="center" valign="middle" >25</td><td align="center" valign="middle" >HCHASCLTNCLPSCGSGCCSADEER</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 7, peptide 1 (c75440_g1)</td><td align="center" valign="middle" >28</td><td align="center" valign="middle" >DSTETGEPGNYGVGFPTFLGKVEDPEAR**</td><td align="center" valign="middle"  rowspan="2"  >Sym fucoxanthin-chlorophyll a-c binding protein</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 7, peptide 2 (c75440_g1)</td><td align="center" valign="middle" >8</td><td align="center" valign="middle" >LAAELANGR</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 7, peptide 3 (c75440_g1)</td><td align="center" valign="middle" >26</td><td align="center" valign="middle" >ELGVQDPIGFWDPLGLSADKDEATFK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 8, peptide 1 (c76783_g1)</td><td align="center" valign="middle" >31</td><td align="center" valign="middle" >TPVSESSDERSNSDSSDHNLERESSPVKRRK</td><td align="center" valign="middle"  rowspan="2"  >host serine/arginine repetitive matrix protein 2</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 8, peptide 2 (c76783_g1)</td><td align="center" valign="middle" >32</td><td align="center" valign="middle" >QRHLDKSDARRERKMRDDHENRHDEERLRRER</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 9 (c80461_g1)</td><td align="center" valign="middle" >25</td><td align="center" valign="middle" >KTVKVLRVLRVLRPLKAINKAKKLK*</td><td align="center" valign="middle" >host voltage-dependent R-type calcium channel subunit alpha-1E-like isoform X2</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 10, peptide 1 (c86107_g1)</td><td align="center" valign="middle" >20</td><td align="center" valign="middle" >TRKLKSRIIKRIRRLRVLRR</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 3, protein 10, peptide 2 (c86107_g1)</td><td align="center" valign="middle" >21</td><td align="center" valign="middle" >KAKQVLVKRVRKMKRKIKRRK</td><td align="center" valign="middle" ></td></tr></tbody></table></table-wrap><table-wrap id="4_5"><table><tbody><thead><tr><th align="center" valign="middle" >Name</th><th align="center" valign="middle" >Length (#AA)</th><th align="center" valign="middle" >Sequence</th><th align="center" valign="middle" >Protein identity</th></tr></thead><tr><td align="center" valign="middle" >HWN &gt; HBH spot 4, protein 1 (c62634_g1)</td><td align="center" valign="middle" >28</td><td align="center" valign="middle" >SVKKVTKKAKKAKKAKKVIRKRKAPAKR*</td><td align="center" valign="middle" >host protamine</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 4, protein 2, peptide 1 (c80550_g3)</td><td align="center" valign="middle" >14</td><td align="center" valign="middle" >FTCANGHCINFDWK</td><td align="center" valign="middle"  rowspan="2"  >host prolow-density lipoprotein receptor-related protein 1</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 4, protein 2, peptide 2 (c80550_g3)</td><td align="center" valign="middle" >20</td><td align="center" valign="middle" >RWQCDGEDDCGDGSDEGLCK</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 4, protein 2, peptide 3 (c80550_g3)</td><td align="center" valign="middle" >29</td><td align="center" valign="middle" >CVMMSYVCDGYNDCGDASDEHPKEGCLLR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 1, peptide 1 (c13654_g1)</td><td align="center" valign="middle" >22</td><td align="center" valign="middle" >EYMEQWDQATIAFRTGYEVAKR</td><td align="center" valign="middle"  rowspan="2"  >Sym ankyrin repeat domain-containing protein 50</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 1, peptide 2 (c13654_g1)</td><td align="center" valign="middle" >16</td><td align="center" valign="middle" >VILIQAAARGFLIRRR</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 2 (c167493_g1)</td><td align="center" valign="middle" >60</td><td align="center" valign="middle" >LTVQVVVRTQEGSYIGETRYTYNSNLLSQFEQCVKAMDDEDMELDCTGSP*</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 3 (c168524_g1)</td><td align="center" valign="middle" >27</td><td align="center" valign="middle" >TLLLRKRKSLTLSLESLGKRLKVLELR*</td><td align="center" valign="middle" >host short-chain collagen C4</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 4 (c170150_g1)</td><td align="center" valign="middle" >34</td><td align="center" valign="middle" >KSTKVMHNFEDDDGNNEEED KENDSGFGRYEEMR*</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 5, peptide 1 (c41865_g1)</td><td align="center" valign="middle" >30</td><td align="center" valign="middle" >NLRFPHLLRFPDLPHLLKRKLRQQRKRPLR</td><td align="center" valign="middle" >unknown</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 5, peptide 2 (c41865_g1)</td><td align="center" valign="middle" >32</td><td align="center" valign="middle" >HRQLRVRQTQQLRLQGLLPLLSQLRRRNQRHR</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 6 (c45226_g1)</td><td align="center" valign="middle" >31</td><td align="center" valign="middle" >DDDGDKWLDNESNDFSSSEGEVDDNEKDDWK*</td><td align="center" valign="middle" >unknown</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 7 (c46638_g1)</td><td align="center" valign="middle" >29</td><td align="center" valign="middle" >KGSKKKKGSKKKKGSKKKKKKGKKKGKKK*</td><td align="center" valign="middle" >unknown</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 8, peptide 1 (c51777_g1)</td><td align="center" valign="middle" >18</td><td align="center" valign="middle" >TQMIPNRTYCIWYQVEPR</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 8, peptide 2 (c51777_g1)</td><td align="center" valign="middle" >38</td><td align="center" valign="middle" >DQPLETKPLETVRLAQLLSLGFT VISEEANSLDSELYK</td><td align="center" valign="middle" ></td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 9 (c52097_g1)</td><td align="center" valign="middle" >30</td><td align="center" valign="middle" >LRKKIREATLAGIREKKKHVDRMHRKRRFR*</td><td align="center" valign="middle" >Sym DEAD-box ATP-dependent RNA helicase 35</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 10 (c72431_g1)</td><td align="center" valign="middle" >30</td><td align="center" valign="middle" >KPKKEKKKKKGKKEKKKKDKKDKKEKKKKK*</td><td align="center" valign="middle" >host Schlafen family member 5</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 11, peptide 1 (c77868_g2)</td><td align="center" valign="middle" >36</td><td align="center" valign="middle" >KRLEERRRERILERKVQRRIEREE KERKEKEEREKR</td><td align="center" valign="middle"  rowspan="2"  >host eukaryotic translation initiation factor 3 subunit A-like</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 11, peptide 2 (c77868_g2)</td><td align="center" valign="middle" >20</td><td align="center" valign="middle" >WRDDRGRDDRGRDDRWRVDR</td></tr></tbody></table></table-wrap><table-wrap id="4_6"><table><tbody><thead><tr><th align="center" valign="middle" >Name</th><th align="center" valign="middle" >Length (#AA)</th><th align="center" valign="middle" >Sequence</th><th align="center" valign="middle" >Protein identity</th></tr></thead><tr><td align="center" valign="middle" >HWN &gt; HBH spot 5, protein 12 (c97047_g1)</td><td align="center" valign="middle" >24</td><td align="center" valign="middle" >KKDKKKSDKKKKKDKKKKKDKKKK**</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 6, protein 1 (c29807_g1)</td><td align="center" valign="middle" >18</td><td align="center" valign="middle" >YLRILRLLRLARLLRVIK</td><td align="center" valign="middle" >Sym serine/threonine protein kinase pelle</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 6, protein 2 (c37817_g1)</td><td align="center" valign="middle" >21</td><td align="center" valign="middle" >VTEVVLLEREQRVRARLLRPK</td><td align="center" valign="middle" >unknown Sym</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 6, protein 3 (c48738_g1)</td><td align="center" valign="middle" >20</td><td align="center" valign="middle" >EKKHKDKEHKKDKKEKKEKK</td><td align="center" valign="middle" >Sym DNA topoisomerase I</td></tr><tr><td align="center" valign="middle" >HWN &gt; HBH spot 6, protein 4 (c52240_g1)</td><td align="center" valign="middle" >28</td><td align="center" valign="middle" >RFKGILKIRRKKMKKHKYRKRRKRDLFK*</td><td align="center" valign="middle" >unknown host</td></tr><tr><td align="center" valign="middle"  colspan="3"  >mean length of sequenced peptide (excluding overlapping samples)</td><td align="center" valign="middle" >22 &#177; 9 (std. dev.) AA</td></tr><tr><td align="center" valign="middle"  colspan="3"  >total number of proteins</td><td align="center" valign="middle" >53</td></tr><tr><td align="center" valign="middle"  colspan="3"  >total number of contiguous peptide sequences</td><td align="center" valign="middle" >95</td></tr><tr><td align="center" valign="middle"  colspan="3"  >total number of peptides sequenced</td><td align="center" valign="middle" >129</td></tr></tbody></table></table-wrap></table-wrap-group><p><sup>a</sup>compartment of origin could not be verified.</p></sec></body><back><ref-list><title>References</title><ref id="scirp.83045-ref1"><label>1</label><mixed-citation publication-type="other" xlink:type="simple">Hoegh-Guldberg, O., Mumby, P.J., Hooten, A.J., Steneck, R.S., Greenfield, P., Gomez, E., Harvell, C.D., Sale, P.F., Caldeira, K., Knowlton, N., Eakin, C.M., Iglesias-Prieto, R., Muthiga, N., Bradbury, R.H., Dubi, A. and Hatziolos, M.E. (2007) Coral Reefs under Rapid Climate Change and Ocean Acidification. Science, 318, 1737-1742. https://doi.org/10.1126/science.1152509</mixed-citation></ref><ref id="scirp.83045-ref2"><label>2</label><mixed-citation publication-type="other" xlink:type="simple">Putnam, H.M., Barott, K., Ainsworth, T.D. and Gates, R.D. (2017) The Vulnerability and Resilience of Reef-Building Corals. Current Biology, 27, R528-R540.  
https://doi.org/10.1016/j.cub.2017.04.047</mixed-citation></ref><ref id="scirp.83045-ref3"><label>3</label><mixed-citation publication-type="other" xlink:type="simple">Brown, B.E. (1997) Coral Bleaching: Causes and Consequences. Coral Reefs, 16, s129-s138. https://doi.org/10.1007/s003380050249</mixed-citation></ref><ref id="scirp.83045-ref4"><label>4</label><mixed-citation publication-type="other" xlink:type="simple">Gates, R.D. and Edmunds, P.J. (1999) The Physiological Mechanisms of Acclimatization in Tropical Reef Corals. Integrative and Comparative Biology, 39, 30-43. 
https://doi.org/10.1093/icb/39.1.30</mixed-citation></ref><ref id="scirp.83045-ref5"><label>5</label><mixed-citation publication-type="other" xlink:type="simple">Barshis, D.J., Stillman, J.H., Gates, R.D., Toonen, R.J., Smith, L.W. and Birkeland, C. (2010) Protein Expression and Genetic Structure of the Coral Porites lobata in an Environmentally Extreme Samoan Back Reef: Does Host Genotype Limit Phenotypic Plasticity? Molecular Ecology, 19, 1705-1720.  
https://doi.org/10.1111/j.1365-294X.2010.04574.x</mixed-citation></ref><ref id="scirp.83045-ref6"><label>6</label><mixed-citation publication-type="other" xlink:type="simple">Krueger, T., Horwitz, N., Bodin, J., Giovani, M.E., Escrig, S., Meibom, A. and Fine, M. (2017) Common Reef-Building Coral in the Northern Red Sea Resistant to Elevated Temperature and Acidification. Royal Society Open Science, 4, Article ID: 170038. https://doi.org/10.1098/rsos.170038</mixed-citation></ref><ref id="scirp.83045-ref7"><label>7</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chen, M., Meng, P.J., Lin, H.J., Chen, C.S. and Liu, P.J. (2013) The Physiological Response of the Reef Coral Pocillopora damicornis to Elevated Temperature: Results from Coral Reef Mesocosm Experiments in Southern Taiwan. Marine and Environmental Research, 86, 1-11.  
https://doi.org/10.1016/j.marenvres.2013.01.004</mixed-citation></ref><ref id="scirp.83045-ref8"><label>8</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Fan, T.Y. and Chen, C.S. (2013) Physiological Acclimation to Elevated Temperature in a Reef-Building Coral from an Upwelling Environment. Coral Reefs, 32, 909-921. https://doi.org/10.1007/s00338-013-1067-4</mixed-citation></ref><ref id="scirp.83045-ref9"><label>9</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Fan, T.Y. and Chen, C.S. (2013) Real-Time PCR-Based Gene Expression Analysis in the Model Reef-Building Coral Pocillopora damicornis: Insight from a Salinity Stress Study. Platax, 10, 1-29.</mixed-citation></ref><ref id="scirp.83045-ref10"><label>10</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chen, C.S. and Liu, P.J. (2014) Decreased Green Fluorescent Protein-Like Chromoprotein Gene Expression in Specimens of the Reef-Building Coral Pocillopora damicornis Undergoing High Temperature-Induced Bleaching. Platax, 11, 1-23.</mixed-citation></ref><ref id="scirp.83045-ref11"><label>11</label><mixed-citation publication-type="other" xlink:type="simple">Putnam, H.M. and Edmunds, P.J. (2011) The Physiological Response of Reef Corals to Diel Fluctuations in Seawater Temperature. Journal of Experimental Marine Biology and Ecology, 396, 216-223. https://doi.org/10.1016/j.jembe.2010.10.026</mixed-citation></ref><ref id="scirp.83045-ref12"><label>12</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chan, P.H., Putnam, H.M., Chen, C.S. and Fan, T.Y. (2012) The Effects of a Variable Temperature Regime on the Physiology of the Reef-Building Coral Seriatopora hystrix: Results from a Laboratory-Based Reciprocal Transplant. Journal of Experimental Biology, 215, 4183-4195. https://doi.org/10.1242/jeb.071688</mixed-citation></ref><ref id="scirp.83045-ref13"><label>13</label><mixed-citation publication-type="other" xlink:type="simple">Chen, C.T.A., Hsing, L.Y., Liu, C.L. and Wang, S.L. (2004) Degree of Nutrient Consumption of Upwelled Water in the Taiwan Strait Based on Dissolved Organic Phosphorus or Nitrogen. Marine Chemistry, 87, 73-86.  
https://doi.org/10.1016/j.marchem.2004.01.006</mixed-citation></ref><ref id="scirp.83045-ref14"><label>14</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Fan, T.Y. and Chen, C.S. (2013) The Physiological Impact of ex Situ Transplantation on the Taiwanese Reef-Building Coral Seriatopora hystrix. Journal of Marine Biology, 2013, Article ID: 569369. https://doi.org/10.1155/2013/569361</mixed-citation></ref><ref id="scirp.83045-ref15"><label>15</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chen, Y.H., Dai, C.F. and Chen, C.S. (2014) The Effects of Temperature on Gene Expression in the Reef-Building Coral Seriatopora hystrix: Insight from Aquarium Studies in Southern Taiwan. International Journal of Marine Science, 4, 1-23. https://doi.org/10.5376/ijms.2014.04.0050</mixed-citation></ref><ref id="scirp.83045-ref16"><label>16</label><mixed-citation publication-type="book" xlink:type="simple">Mayfield, A.B., Chen, Y.J., Lu, C.Y. and Chen, C.S. (2016) Proteins Responsive to Variable Temperature Exposure in the Reef-Building Coral Seriatopora hystrix. In: Ortiz, S., Ed., Coral Reefs: Ecosystems, Environmental Impact and Current Threats, NOVA Publishing, New York, 1-60.</mixed-citation></ref><ref id="scirp.83045-ref17"><label>17</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Wang, Y.B., Chen, C.S., Chen, S.H. and Lin, C.Y. (2016) Dual-Compartmental Transcriptomic + Proteomic Analysis of a Marine Endosymbiosis Exposed to Environmental Change. Molecular Ecology, 25, 5944-5958.  
https://doi.org/10.1111/mec.13896</mixed-citation></ref><ref id="scirp.83045-ref18"><label>18</label><mixed-citation publication-type="other" xlink:type="simple">Peng, S.E., Chen, W.N.U., Chen, H.K., Lu, C.Y., Mayfield, A.B., Fang, L.S. and Chen, C.S. (2011) Lipid Bodies in Coral-Dinoflagellate Endosymbiosis: Ultrastructural and Proteomic Analyses. Proteomics, 17, 3540-3455.  
https://doi.org/10.1002/pmic.201000552</mixed-citation></ref><ref id="scirp.83045-ref19"><label>19</label><mixed-citation publication-type="other" xlink:type="simple">Weston, A.J., Dunlap, W.C., Shick, J.M., Klueter, A., Iglic, K., Vukelic, A., Starcevic, A., Ward, M., Wells, M.L., Trick, C.G. and Long, P.F. (2012) A Profile of an Endosymbiont-Enriched Fraction of the Coral Stylophora pistillata Reveals Proteins Relevant to Microbial-Host Interactions. Molecular and Cellular Proteomics, 11, M111.015487. https://doi.org/10.1074/mcp.M111.015487</mixed-citation></ref><ref id="scirp.83045-ref20"><label>20</label><mixed-citation publication-type="other" xlink:type="simple">Oakley, C.A., Ameismeier, M.F., Peng, L., Weis, V.M., Grossman, A.R. and Davy, S.K. (2016) Symbiosis Induces Widespread Changes in the Proteome of the Model Cnidarian Aiptasia. Cellular Microbiology, 18, 1009-1023.  
https://doi.org/10.1111/cmi.12564</mixed-citation></ref><ref id="scirp.83045-ref21"><label>21</label><mixed-citation publication-type="other" xlink:type="simple">Weston, A.J., Dunlap, W.C., Beltran, V.H., Starcevic, A., Hranueli, D., Ward, M. and Long, P.F. (2015) Proteomics Links the Redox State to Calcium Signaling during Bleaching of the Scleractinian Coral Acropora microphthalma on Exposure to High Solar Irradiance and Thermal Stress. Molecular and Cellular Proteomics, 14, 585-595. https://doi.org/10.1074/mcp.M114.043125</mixed-citation></ref><ref id="scirp.83045-ref22"><label>22</label><mixed-citation publication-type="other" xlink:type="simple">Liu, P.J., Meng, P.J., Liu, L.L., Wang, J.T. and Leu, M.Y. (2012) Impacts of Human Activities on Coral Reef Ecosystems of Southern Taiwan: A Long-Term Study. Marine Pollution Bulletin, 64, 1129-1135. https://doi.org/10.1016/j.marpolbul.2012.03.031</mixed-citation></ref><ref id="scirp.83045-ref23"><label>23</label><mixed-citation publication-type="other" xlink:type="simple">Ribas-Deulofeu, L., Denis, V., De Palmas, S., Kuo, C.Y., Hsieh, H.J. and Chen, C.A. (2016) Structure of Benthic Communities along the Taiwan Latitudinal Gradient. PLoS ONE, 11, e0160601. https://doi.org/10.1371/journal.pone.0160601</mixed-citation></ref><ref id="scirp.83045-ref24"><label>24</label><mixed-citation publication-type="other" xlink:type="simple">Tkachenko, K.S., Wu, B.J., Fang, L.S. and Fan, T.Y. (2007) Dynamics of a Coral Reef Community after Mass Mortality of Branching Acropora Corals and an Outbreak of Anemones. Marine Biology, 151, 185-194. https://doi.org/10.1007/s00227-006-0467-1</mixed-citation></ref><ref id="scirp.83045-ref25"><label>25</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Wang, L.H., Tang, P.C., Hsiao, Y.Y., Fan, T.Y., Tsai, C.L. and Chen, C.S. (2011) Assessing the Impacts of Experimentally Elevated Temperature on the Biological Composition and Molecular Chaperone Gene Expression of a Reef Coral. PLoS ONE, 6, e26529. https://doi.org/10.1371/journal.pone.0026529</mixed-citation></ref><ref id="scirp.83045-ref26"><label>26</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chen, Y.J., Lu, C.Y. and Chen, C.S. (2018) The Proteomic Response of the Reef Coral Pocillopora acuta to Experimentally Elevated Temperature. PLoS ONE, 13, e0192001. https://doi.org/10.1371/journal.pone.0192001</mixed-citation></ref><ref id="scirp.83045-ref27"><label>27</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B. (2016) Uncovering Spatio-Temporal and Treatment-Derived Differences in the Molecular Physiology of a Model Coral-Dinoflagellate Mutualism with Multivariate Statistical Approaches. Journal of Marine Science and Engineering, 4, 63. https://doi.org/10.3390/jmse4030063</mixed-citation></ref><ref id="scirp.83045-ref28"><label>28</label><mixed-citation publication-type="other" xlink:type="simple">Kim, S. and Pevzner, P.A. (2014) MS-GF+ Makes Progress towards a Universal Database Search Tool for Proteomics. Nature Communication, 5, 5277.  
https://doi.org/10.1038/ncomms6277</mixed-citation></ref><ref id="scirp.83045-ref29"><label>29</label><mixed-citation publication-type="other" xlink:type="simple">Chiva, C., Ortega, M. and Sabido, E. (2014) Influence of the Digestion Technique, Protease, and Missed Cleavage Peptides in Protein Quantitation. Journal of Proteome Research, 13, 3979-3986. https://doi.org/10.1021/pr500294d</mixed-citation></ref><ref id="scirp.83045-ref30"><label>30</label><mixed-citation publication-type="other" xlink:type="simple">Rudnick, P.A., Markey, S.P., Roth, J., Mirokhin, Y., Yan, X., Tchekhovskoi, D.V., Edwards, N.J., Thangudu, R.R., Ketchum, K.A., Kinsinger, C.R., Mesri, M., Rodriguez, H. and Stein, S. (2016) A Description of the Clinical Proteomic Tumor Analysis Consortium (CPTAC) Common Data Analysis Pipeline. Journal of Proteome Research, 15, 1023-1032. https://doi.org/10.1021/acs.jproteome.5b01091</mixed-citation></ref><ref id="scirp.83045-ref31"><label>31</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Hsiao, Y.Y., Fan, T.Y. and Chen, C.S. (2012) Temporal Variation in RNA/DNA and Protein/DNA Ratios in Four Anthozoan-Dinoflagellate Endosymbioses of the Indo-Pacific: Implications for Molecular Diagnostics. Platax, 9, 1-24.</mixed-citation></ref><ref id="scirp.83045-ref32"><label>32</label><mixed-citation publication-type="other" xlink:type="simple">Chen, H.K., Song, S.N., Wang, L.H., Mayfield, A.B., Chen, Y.J., Chen, W.N.U. and Chen, C.S. (2015) A Compartmental Comparison of Major Lipid Species in a Coral-Symbiodinium Endosymbiosis: Evidence That the Coral Host Regulates Lipogenesis of Its Cytosolic Lipid Bodies. PLoS ONE, 10, e0132519.  
https://doi.org/10.1371/journal.pone.0132519</mixed-citation></ref><ref id="scirp.83045-ref33"><label>33</label><mixed-citation publication-type="other" xlink:type="simple">Chen, W.N.U., Hsiao, Y.J., Mayfield, A.B., Young, R., Hsu, L., Chen, C.S. and Peng, S.E. (2016) Vertical Transmission of Heterologous Clade C Symbiodinium in a Model Anemone Infection System. Peer J, 4, e2358.  
https://doi.org/10.7717/peerj.2358</mixed-citation></ref><ref id="scirp.83045-ref34"><label>34</label><mixed-citation publication-type="other" xlink:type="simple">Chen, H.K., Mayfield, A.B., Wang, L.H. and Chen, C.S. (2017) Coral Lipid Bodies as the Relay Center Interconnecting Diel-Dependent Lipidomic Changes in Different Cellular Compartments. Scientific Reports, 7, 3244.  
https://doi.org/10.1038/s41598-017-02722-z</mixed-citation></ref><ref id="scirp.83045-ref35"><label>35</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chen, C.S., Dempsey, A.C. and Bruckner, A.W. (2016) The Molecular Ecophysiology of Closely Related Pocilloporids from the South Pacific: A Case Study from the Austral and Cook Islands. Platax, 13, 1-25.</mixed-citation></ref><ref id="scirp.83045-ref36"><label>36</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chen, C.S. and Dempsey, A.C. (2017) Biomarker Profiling in Reef Corals of Tonga’s Ha’apai and Vava’u Archipelagos. PLoS ONE, 12, e0185857.  
https://doi.org/10.1371/journal.pone.0185857</mixed-citation></ref><ref id="scirp.83045-ref37"><label>37</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Chen, C.S. and Dempsey, A.C. (2017) Identifying Corals Displaying Aberrant Behavior in Fiji’s Lau Archipelago. PLoS ONE, 12, e0177267.  
https://doi.org/10.1371/journal.pone.0177267</mixed-citation></ref><ref id="scirp.83045-ref38"><label>38</label><mixed-citation publication-type="other" xlink:type="simple">Cantwell, R.E. and Hofmann, R. (2011) Ultraviolet Absorption Properties of Suspended Particulate Matter in Untreated Surface Waters. Water Research, 45, 1322-1328. https://doi.org/10.1016/j.watres.2010.10.020</mixed-citation></ref><ref id="scirp.83045-ref39"><label>39</label><mixed-citation publication-type="other" xlink:type="simple">Lesser, M.P. (1996) Elevated Temperatures and Ultraviolet Radiation Cause Oxidative Stress and Inhibit Photosynthesis in Symbiotic Dinoflagellates. Limnology and Oceanography, 41, 271-283. https://doi.org/10.4319/lo.1996.41.2.0271</mixed-citation></ref><ref id="scirp.83045-ref40"><label>40</label><mixed-citation publication-type="other" xlink:type="simple">Lundgren, P., Vera, J.C., Peplow, L., Manel, S. and van Oppen, M.J.H. (2013) Genotype-Environment Correlations in Corals from the Great Barrier Reef. BMC Genetics, 14, 9. https://doi.org/10.1186/1471-2156-14-9</mixed-citation></ref><ref id="scirp.83045-ref41"><label>41</label><mixed-citation publication-type="other" xlink:type="simple">Meyer, E., Davies, S., Wang, S., Willis, B.L., Abrego, D., Juenger, T.E. and Matz, M.V. (2009) Genetic Variation in Responses to a Settlement Cue and Elevated Temperature in the Reef-Building Coral Acropora millepora. Marine Ecology Progress Series, 392, 81-92. https://doi.org/10.3354/meps08208</mixed-citation></ref><ref id="scirp.83045-ref42"><label>42</label><mixed-citation publication-type="other" xlink:type="simple">Barshis, D.J., Ladner, J.T., Oliver, T.A., Seneca, F.O., Traylor-Knowles, N. and Palumbi, S.R. (2013) Genomic Basis for Coral Resilience to Climate Change. Proceedings of the National Academy of Sciences of the United States of America, 110, 1387-1392. https://doi.org/10.1073/pnas.1210224110</mixed-citation></ref><ref id="scirp.83045-ref43"><label>43</label><mixed-citation publication-type="other" xlink:type="simple">Hochachka, P.W. and Somero, G.N. (2002) Biochemical Adaptation. Oxford University Press, Oxford.</mixed-citation></ref><ref id="scirp.83045-ref44"><label>44</label><mixed-citation publication-type="other" xlink:type="simple">Dong, Y., Miller, L.P., Sanders, J.G. and Somero, G.N. (2008) Heat-Shock Protein 70 (Hsp70) Expression in Four Limpets of the Genus Lottia: Interspecific Variation in Constitutive and Inducible Synthesis Correlates with in Situ Exposure to Heat Stress. The Biological Bulletin, 215, 173-181. https://doi.org/10.2307/25470698</mixed-citation></ref><ref id="scirp.83045-ref45"><label>45</label><mixed-citation publication-type="other" xlink:type="simple">Fabricius, K.E. (2005) Effects of Terrestrial Run of on the Ecology of Corals and Coral Reefs: Review and Synthesis. Marine Pollution Bulletin, 50, 125-146.  
https://doi.org/10.1016/j.marpolbul.2004.11.028</mixed-citation></ref><ref id="scirp.83045-ref46"><label>46</label><mixed-citation publication-type="other" xlink:type="simple">Liu, P.J., Hsin, M.C., Huang, Y.H., Fan, T.Y., Meng, P.J., Lu, C.C. and Lin, H.J. (2015) Nutrient Enrichment Coupled with Sedimentation Favors Sea Anemones over Corals. PLoS ONE, 10, e0125175. https://doi.org/10.1371/journal.pone.0125175</mixed-citation></ref><ref id="scirp.83045-ref47"><label>47</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B. and Gates, R.D. (2007) Osmoregulation in Anthozoan-Dinoflagellate Symbiosis. Comparative Biochemistry and Physiology Part A: Molecular &amp; Integrative Physiology, 147, 1-10. https://doi.org/10.1016/j.cbpa.2006.12.042</mixed-citation></ref><ref id="scirp.83045-ref48"><label>48</label><mixed-citation publication-type="other" xlink:type="simple">Jones, R.J., Hoegh-Guldberg, O., Larkum, A.W.D. and Schreiber, U. (1998) Temperature-Induced Bleaching of Corals Begins with Impairment of the CO2 Fixation Metabolism in Zooxanthellae. Plant, Cell and Environment, 21, 1219-1230.  
https://doi.org/10.1046/j.1365-3040.1998.00345.x</mixed-citation></ref><ref id="scirp.83045-ref49"><label>49</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Hsiao, Y.Y., Fan, T.Y., Chen, C.S. and Gates, R.D. (2010) Evaluating the Temporal Stability of Stress-Activated Protein Kinase and Cytoskeleton Gene Expression in the Pacific Corals Pocillopora damicornis and Seriatopora hystrix. Journal of Experimental Marine Biology and Ecology, 395, 215-222.  
https://doi.org/10.1016/j.jembe.2010.09.007</mixed-citation></ref><ref id="scirp.83045-ref50"><label>50</label><mixed-citation publication-type="other" xlink:type="simple">Thirone, A.C.P., Speight, P., Zulys, M., Rotstein, O.D., Szaszi, K., Pedersen, S.F. and Kapus, A. (2009) Hyperosmotic Stress Induces Rho/Rho Kinase/LIM Kinase-Mediated Cofilin Phosphorylation in Tubular Cells: Key Role in the Osmotically Triggered F-Actin Response. American Journal of Physiology-Cell Physiology, 296, C463-C475. https://doi.org/10.1152/ajpcell.00467.2008</mixed-citation></ref><ref id="scirp.83045-ref51"><label>51</label><mixed-citation publication-type="other" xlink:type="simple">Desalvo, M.K., Voolstra, C.R., Sunagawa, S., Schwarz, J., Stillman, J.H., Coffroth, M.A., Szmant-Froelich, A.M. and Medina, M. (2008) Differential Gene Expression during Thermal Stress and Bleaching in the Caribbean Coral Montastraea faveolata. Molecular Ecology, 17, 3952-3971. https://doi.org/10.1111/j.1365-294X.2008.03879.x</mixed-citation></ref><ref id="scirp.83045-ref52"><label>52</label><mixed-citation publication-type="other" xlink:type="simple">Palumbi, S.R., Barshis, D.J., Traylor-Knowles, N. and Bay, R.A. (2014) Mechanisms of Reef Coral Resistance to Future Climate Change. Science, 344, 895-898.  
https://doi.org/10.1126/science.1251336</mixed-citation></ref><ref id="scirp.83045-ref53"><label>53</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Wang, Y.B., Chen, C.S., Chen, S.H. and Lin, C.Y. (2014) Compartment-Specific Transcriptomics in a Reef-Building Coral Exposed to Elevated Temperatures. Molecular Ecology, 23, 5816-5830. https://doi.org/10.1111/mec.12982</mixed-citation></ref><ref id="scirp.83045-ref54"><label>54</label><mixed-citation publication-type="other" xlink:type="simple">Downs, C.A., Mueller, E., Phillips, S., Fauth, J.E. and Woodley, C.M. (2000) A Molecular Biomarker System for Assessing the Health of Coral (Montastrea faveolata) during Heat Stress. Marine Biotechnology, 2, 533-544.  
https://doi.org/10.1007/s101260000038</mixed-citation></ref><ref id="scirp.83045-ref55"><label>55</label><mixed-citation publication-type="other" xlink:type="simple">Mayfield, A.B., Hirst, M.B. and Gates, R.D. (2009) Gene Expression Normalization in a Dual-Compartment System: A Real-Time PCR Protocol for Symbiotic Anthozoans. Molecular Ecology Resources, 9, 462-470.  
https://doi.org/10.1111/j.1755-0998.2008.02349.x</mixed-citation></ref><ref id="scirp.83045-ref56"><label>56</label><mixed-citation publication-type="other" xlink:type="simple">Putnam, H.M., Mayfield, A.B., Fan, T.Y., Chen, C.S. and Gates, R.D. (2013) The Physiological and Molecular Responses of Larvae from the Reef-Building Coral Pocillopora damicornis Exposed to Near-Future Increases in Temperature &amp; pCO2. Marine Biology, 160, 2157-2173. https://doi.org/10.1007/s00227-012-2129-9</mixed-citation></ref></ref-list></back></article>