<?xml version="1.0" encoding="UTF-8"?><!DOCTYPE article  PUBLIC "-//NLM//DTD Journal Publishing DTD v3.0 20080202//EN" "http://dtd.nlm.nih.gov/publishing/3.0/journalpublishing3.dtd"><article xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink" dtd-version="3.0" xml:lang="en" article-type="research article"><front><journal-meta><journal-id journal-id-type="publisher-id">WJNS</journal-id><journal-title-group><journal-title>World Journal of Neuroscience</journal-title></journal-title-group><issn pub-type="epub">2162-2000</issn><publisher><publisher-name>Scientific Research Publishing</publisher-name></publisher></journal-meta><article-meta><article-id pub-id-type="doi">10.4236/wjns.2015.55036</article-id><article-id pub-id-type="publisher-id">WJNS-61173</article-id><article-categories><subj-group subj-group-type="heading"><subject>Articles</subject></subj-group><subj-group subj-group-type="Discipline-v2"><subject>Biomedical&amp;Life Sciences</subject></subj-group></article-categories><title-group><article-title>
 
 
  Potential PET Ligands for Imaging of Cerebral VPAC and PAC Receptors: Are Non-Peptide Small Molecules Superior to Peptide Compounds?
 
</article-title></title-group><contrib-group><contrib contrib-type="author" xlink:type="simple"><name name-style="western"><surname>argit</surname><given-names>Pissarek</given-names></name><xref ref-type="aff" rid="aff1"><sub>1</sub></xref><xref ref-type="corresp" rid="cor1"><sup>*</sup></xref></contrib></contrib-group><aff id="aff1"><label>1</label><addr-line>INM-5, Nuclear Chemistry, Institute of Neurosciences and Medicine, Research Centre Jülich,Jülich, Germany</addr-line></aff><author-notes><corresp id="cor1">* E-mail:<email>m.pissarek@fz-juelich.de</email></corresp></author-notes><pub-date pub-type="epub"><day>18</day><month>09</month><year>2015</year></pub-date><volume>05</volume><issue>05</issue><fpage>364</fpage><lpage>384</lpage><history><date date-type="received"><day>15</day>	<month>August</month>	<year>2015</year></date><date date-type="rev-recd"><day>accepted</day>	<month>13</month>	<year>November</year>	</date><date date-type="accepted"><day>17</day>	<month>November</month>	<year>2015</year></date></history><permissions><copyright-statement>&#169; Copyright  2014 by authors and Scientific Research Publishing Inc. </copyright-statement><copyright-year>2014</copyright-year><license><license-p>This work is licensed under the Creative Commons Attribution International License (CC BY). http://creativecommons.org/licenses/by/4.0/</license-p></license></permissions><abstract><p>
 
 
  Pituitary adenylate cyclase activating polypeptide (PACAP) and vasoactive intestinal peptide (VIP) have been known for decades to mediate neuroendocrine and vasodilative actions via G-protein-coupled receptors of Class B. These are targets of imaging probes for positron emission tomography (PET) or single photon emission tomography (SPECT) in tumor diagnostics and tumor grading. However, they play only a subordinate role in the development of tracers for brain imaging. Difficulties in development of non-peptide ligands typical for cerebral receptors of PACAP and VIP are shared by all members of Class B receptor family. Essential landmarks have been confirmed for understanding of structural details of Class B receptor molecular signalling during the last five years. High relevance in the explanation of problems in ligand development for these receptors is admitted to the large N-terminal
   
  ectodomain markedly different from Class A receptor binding sites and poorly suitable as orthosteric binding sites for the most small-molecule compounds. The present study is focused on the recently available receptor ligands for PAC1, VPAC1 and VPAC2 receptors as well as potential small-molecule lead structures suitable for use in PET or SPECT. Recently, biaryl, cyanothiophene and pentanamide structures with affinities in nM-range have been proposed as non-peptide ligands at VPAC1 and VPAC2 receptors. However, most of these ligands have been classified as non-competitive related to the orthosteric binding site of endogenous peptide ligands of VPAC receptors. For PAC1 receptors have been identified hydrazide compounds for which an inhibitory and potentially competitive mechanism of receptor binding has been postulated based on molecular docking studies.
 
</p></abstract><kwd-group><kwd>Class B Receptors</kwd><kwd> Vasoactive Intestinal Peptide</kwd><kwd> Pituitary Adenylate Cyclase Activating Polypeptide</kwd><kwd> Non-Peptide Ligands</kwd><kwd> PET</kwd><kwd> SPECT</kwd></kwd-group></article-meta></front><body><sec id="s1"><title>1. Introduction</title><p>Vasoactive intestinal peptide (VIP) [<xref ref-type="bibr" rid="scirp.61173-ref1">1</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref2">2</xref>] and pituitary adenylate cyclase activating peptide (PACAP) [<xref ref-type="bibr" rid="scirp.61173-ref3">3</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref4">4</xref>] activate three types of G-protein-coupled receptors (GPCR) which belong to the Class B receptor family (secretin/glucagon/VIP receptors) and have been intensively investigated [<xref ref-type="bibr" rid="scirp.61173-ref5">5</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref7">7</xref>] for their structure-activity relationships (SAR) and localization in peripheral tissues and CNS [<xref ref-type="bibr" rid="scirp.61173-ref8">8</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref11">11</xref>] . These PAC1, VPAC1 and VPAC2 receptors can be found in special regions of brain and spinal cord in densities potentially suitable for in vivo imaging with high affinity radiotracer ligands [<xref ref-type="bibr" rid="scirp.61173-ref9">9</xref>] . High attention is paid to these receptors in the areas of pulmology, immunology, diabetology, ophtalmology as well as traumatology predominantly for the development of effective therapeutics [<xref ref-type="bibr" rid="scirp.61173-ref12">12</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref19">19</xref>] . However, such receptors are rather outsiders regarding successes in brain imaging with positron emission tomography (PET) and single photon emission tomography (SPECT). Brain disorders providing potential therapeutic applications for ligands of these receptors include chronic inflammatory diseases, neurodegenerative disorders, schizophrenia and stress reactions [<xref ref-type="bibr" rid="scirp.61173-ref14">14</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref15">15</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref20">20</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref21">21</xref>] . The diagnostic possibilities of small-molecule PET-receptor ligands have been not finally assessed up to now. Modern crystallographic and molecular biological methods allowed the discovery of functional variations of these receptors to play a role in the switch between distinct regulatory pathways and permit insights in the manifold regulatory possibilities of these structures [<xref ref-type="bibr" rid="scirp.61173-ref10">10</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref22">22</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref25">25</xref>] as well as of species differences [<xref ref-type="bibr" rid="scirp.61173-ref26">26</xref>] . However, only few non-peptide small-mo- lecule ligands are available for receptors of VIP and PACAP hitherto. But other Class B GPCR receptors, characterized by similar conformations of the N-terminal ectodomain (N-ted), have been a target of in vivo neuroimaging experiments for detection of disease-related alterations for many years. Some success has been reported in the development of positron-emitter-labelled non-peptide compounds. Thus, in vivo trials were reported for imaging of ligands of corticotrophin releasing factor receptors (CRFR) and of calcitonin gene-related peptide receptors (CGRPR) in monkeys in 2007 [<xref ref-type="bibr" rid="scirp.61173-ref27">27</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref29">29</xref>] and 2013 [<xref ref-type="bibr" rid="scirp.61173-ref30">30</xref>] , respectively.</p><p>Structural differences between the N-teds recently described for Class A and Class B GPCRs as binding sites for endogenous peptides have been confirmed also by crystallographic studies [<xref ref-type="bibr" rid="scirp.61173-ref31">31</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref37">37</xref>] . Additionally, receptor activity modulating proteins (RAMP) have been found for almost all Class B receptors up to now (cf. <xref ref-type="table" rid="table1">Table 1</xref>).</p><fig id="fig1"  position="float"><label><xref ref-type="fig" rid="fig1">Figure 1</xref></label><caption><title> Simplified schematic comparison of the N-teds of Class A and Class B receptors. Three potential binding sites of small molecule ligands (mauve) at Class B receptors and RAMP are indicated. Modified according to [<xref ref-type="bibr" rid="scirp.61173-ref48">48</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref84">84</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref132">132</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref133">133</xref>] (yellow: ligand of the receptor, dark blue: N-terminal ectodomain of the receptor; light blue: 7 TM domain</title></caption><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x6.png"/></fig><p>The tasks of these accessory transmembrane proteins have been assigned to the field of the support of the receptor protein in trafficking via the endoplasmatic reticulum to the cellular membrane [<xref ref-type="bibr" rid="scirp.61173-ref35">35</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref41">41</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref42">42</xref>] . Furthermore, a potential role of the RAMP ectodomain in the binding of drugs and imaging probes has been suggested [<xref ref-type="bibr" rid="scirp.61173-ref43">43</xref>] (cf. <xref ref-type="fig" rid="fig1">Figure 1</xref>; cf. <xref ref-type="fig" rid="fig2">Figure 2</xref>).</p><fig id="fig2"  position="float"><label><xref ref-type="fig" rid="fig2">Figure 2</xref></label><caption><title> Some recently discussed functional determinants of Class B receptor signalling. Large N-ted (N-terminal extracellular domain): is the critical structure discussed in the “two domain model” [<xref ref-type="bibr" rid="scirp.61173-ref84">84</xref>] (ligand binding to the N-ted domain initiates a conformation which allows access of the ligand to transmembrane or juxtamembrane orthosteric binding site) and in the “hidden agonist model” (binding of a ligand opens the real binding site for an endogenous agonist) [<xref ref-type="bibr" rid="scirp.61173-ref84">84</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref86">86</xref>] . Helix structure of endogenous peptide ligands: relatively large endoligands allow positioning at the N-ted which cannot easily mimicked by small molecules. RAMP: contribute to trafficking of receptors and their progenitor proteins to the cellular membrane and can be involved in ligand binding at the membrane receptor. CLR: (calcitonin receptor-like receptor): GPCR forming by heterodimerization with different RAMPs several receptor subfamilies. Arrestins: regulatory key signalling proteins probably similar important like G proteins and determining for bias to long- or short-term actions of the receptors. RANTES: microglia mediated mechanism of neuroprotection. Proteasomes: key units of protein catabolism following receptor internalization. Limited capacity might facilitate disturbances of protein folding or protein misfolding</title></caption><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x7.png"/></fig><table-wrap id="table1" ><label><xref ref-type="table" rid="table1">Table 1</xref></label><caption><title> Some Class B receptors and interactions with RAMP subtypes reported to date</title></caption><table><tbody><thead><tr><th align="center" valign="middle" >Receptor</th><th align="center" valign="middle" >Interacts with</th><th align="center" valign="middle" >Reference</th></tr></thead><tr><td align="center" valign="middle" >CFR1</td><td align="center" valign="middle" >RAMP2</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref38">38</xref>]</td></tr><tr><td align="center" valign="middle" >CGRP</td><td align="center" valign="middle" >RAMP1</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref39">39</xref>]</td></tr><tr><td align="center" valign="middle" >CT</td><td align="center" valign="middle" >RAMP1-3</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref39">39</xref>]</td></tr><tr><td align="center" valign="middle" >AM1</td><td align="center" valign="middle" >RAMP2</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>]</td></tr><tr><td align="center" valign="middle" >AM2</td><td align="center" valign="middle" >RAMP3</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>]</td></tr><tr><td align="center" valign="middle" >AMY1-3</td><td align="center" valign="middle" >RAMP1-3</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>]</td></tr><tr><td align="center" valign="middle" >VPAC1</td><td align="center" valign="middle" >RAMP1-3</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref39">39</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref40">40</xref>]</td></tr><tr><td align="center" valign="middle" >VPAC2</td><td align="center" valign="middle" >RAMP1-3</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref38">38</xref>]</td></tr><tr><td align="center" valign="middle" >PTH1</td><td align="center" valign="middle" >RAMP2</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref39">39</xref>]</td></tr><tr><td align="center" valign="middle" >PTH2</td><td align="center" valign="middle" >RAMP3</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>]</td></tr><tr><td align="center" valign="middle" >Secretin</td><td align="center" valign="middle" >RAMP2</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref39">39</xref>]</td></tr><tr><td align="center" valign="middle" >Glucagon</td><td align="center" valign="middle" >RAMP3</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref40">40</xref>]</td></tr><tr><td align="center" valign="middle" >GLP-1</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref38">38</xref>]</td></tr><tr><td align="center" valign="middle" >GLP-2</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref38">38</xref>]</td></tr></tbody></table></table-wrap><p>Labelling of ligands at VIP and PACAP specific receptors with PET or SPECT isotopes has been confined predominantly to peptide compounds which are applied or developed for localization, grading and therapy of cancers [<xref ref-type="bibr" rid="scirp.61173-ref44">44</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref45">45</xref>] . Ligands of VPAC1 and VPAC2 receptors have been employed predominantly for the identification of adenocarcinoma of breast, tumors of prostate, liver, stomach as well as of small cell lung cancer [<xref ref-type="bibr" rid="scirp.61173-ref45">45</xref>] .</p><p>Non-peptide compounds up to now achieved affinities rather in submicromolar than in subnanomolar range. Reports on in vivo imaging experiments are not available. First small molecules of this kind were identified as ligands of the PAC1 receptor seven years ago [<xref ref-type="bibr" rid="scirp.61173-ref46">46</xref>] . An antagonist of the VPAC2 receptor was reported two years later [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] . The present study regards the first lead structures for its pharmacokinetic and binding properties, some further progress in development of VPAC and PAC receptor tracers as well as some of its limitations.</p></sec><sec id="s2"><title>2. VPAC1, VPAC2, PAC1 Receptors and Their Peptide Ligands</title><sec id="s2_1"><title>2.1. Endogenous Ligands PACAP and VIP</title><p>The endogenous ligands at these receptors, PACAP (27 or 38 a.a.r.) and VIP (28 a.a.r.), share some common features with other peptide ligands of the secretin-glucagon family of GPCRs.</p><p>The endogenous ligands of Class B receptors have amino acid sequences in the range between 27 and 44 a.a.r. in mammalian. They are synthetized by endocrine cells, neurons or immune cells. They form α helices and contain an NCap structure in the N-terminal part [<xref ref-type="bibr" rid="scirp.61173-ref18">18</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref48">48</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref49">49</xref>] . PACAP has been recognized as a compound acting as hormone, neurohormone, neurotransmitter and neurotrophic factor [<xref ref-type="bibr" rid="scirp.61173-ref50">50</xref>] . It is found in the brain, cardiovascular system, thyroid, pituitary, adrenal gland and placenta [<xref ref-type="bibr" rid="scirp.61173-ref10">10</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref13">13</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref51">51</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref53">53</xref>] . Both, PACAP and VIP, are regarded as master switches of circadian rhythm [<xref ref-type="bibr" rid="scirp.61173-ref54">54</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref55">55</xref>] . For VIP its role as regulator of growth of whole fetus and of the embryonic brain has been classified as another important long-term effect, while short- term activities with involvement of VIP include exocrine secretion, hormone release, muscle relaxation and metabolic actions [<xref ref-type="bibr" rid="scirp.61173-ref18">18</xref>] . Furthermore, VIP is involved in neuroprotective, antiinflammatory and immunmodulatory effects and influences cell proliferation in cancer cells [<xref ref-type="bibr" rid="scirp.61173-ref10">10</xref>] . The level of PACAP38 in adult brain of mice has been found in the range of 120 fmol/mg protein and the level of VIP at 500 fmol/mg protein [<xref ref-type="bibr" rid="scirp.61173-ref56">56</xref>] . The levels of both peptides are changing from embryonic to adult age in murine brain [<xref ref-type="bibr" rid="scirp.61173-ref57">57</xref>] . PACAP was found at 24 fmol/mg protein at postnatal day 1 and VIP at 9.4 fmol/mg protein [<xref ref-type="bibr" rid="scirp.61173-ref56">56</xref>] at the same stage of development. PACAP achieves levels of the adult brain some days earlier than VIP. It binds to PAC1 with 1000 fold higher affinity than VIP but shows similar affinities to VPAC receptors like VIP [<xref ref-type="bibr" rid="scirp.61173-ref58">58</xref>] .</p><p>The selectivity between the three relevant receptors has been investigated in models of SAR at first for VIP [<xref ref-type="bibr" rid="scirp.61173-ref59">59</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref60">60</xref>] , and subsequently also for PACAP [<xref ref-type="bibr" rid="scirp.61173-ref25">25</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref58">58</xref>] . The first concise pharmacophore model of VIP at VPAC1 and VPAC2 receptors with systematic description of functional relevance of all a.a.r.s was provided by Nicole et al. (2000) [<xref ref-type="bibr" rid="scirp.61173-ref59">59</xref>] . A characterization of PACAP at the PAC1 receptor was later presented by Sun et al. [<xref ref-type="bibr" rid="scirp.61173-ref58">58</xref>] and Kumar et al. [<xref ref-type="bibr" rid="scirp.61173-ref23">23</xref>] . Nicole et al. identified T11 and N28 by alanine scanning, energetic optimization as well as investigations of pharmacodynamics as pivotal structures for the binding of VIP to VPAC receptors. For PACAP38, it has been observed that the removal of the first five amino acids can transform the polypeptide from an agonist at the PAC1 receptor into an antagonist without alteration of the binding affinity [<xref ref-type="bibr" rid="scirp.61173-ref58">58</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref61">61</xref>] .</p><p>Regarding the functional roles of the peptides, for PACAP essential part of attention has been paid to its contribution to stress response [<xref ref-type="bibr" rid="scirp.61173-ref24">24</xref>] , whereas the main fields for VIP investigation are inflammatory diseases [<xref ref-type="bibr" rid="scirp.61173-ref62">62</xref>] and its cytokine-like role. However, for both peptides have been shown influences of knock-out on behavioral functions and on early development in mammals too [<xref ref-type="bibr" rid="scirp.61173-ref24">24</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref35">35</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref63">63</xref>] , e.g. in PACAP and VIP deficient mice was demonstrated an increase of locomotor activity in open field [<xref ref-type="bibr" rid="scirp.61173-ref56">56</xref>] . On the other hand, VPAC2 deficient mice have been shown to be more vulnerable to inductors of experimental colitis than their wild-type littermates [<xref ref-type="bibr" rid="scirp.61173-ref64">64</xref>] . Recently, a potential suitability of PACAP as a predictor of outcome from acute intracerebral ischaemia has been suggested by clinical studies [<xref ref-type="bibr" rid="scirp.61173-ref65">65</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref66">66</xref>] . PACAP38/PAC1 signalling was demonstrated to be an important factor in regulation of trafficking of bone marrow cells which could facilitate their travel to vascular niches after focal cerebral ischaemia [<xref ref-type="bibr" rid="scirp.61173-ref66">66</xref>] . Already 2011 Ressler et al. [<xref ref-type="bibr" rid="scirp.61173-ref67">67</xref>] demonstrated that single nucleotide polymorphisms in the genes of PACAP (ADCYAP1) and PAC1 receptors (ADCYAP1R1) or methylation of the receptors mRNA can result in postischaemic stress disorder. Moreover, altered VIP levels have been described in obese women (low levels) and patients with anorexia nervosa [<xref ref-type="bibr" rid="scirp.61173-ref68">68</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref69">69</xref>] . Furthermore, VIP is suggested to be involved in circuits regulating stimulation of the dentate subgranular stem cell niche and it is co-expressed by GABAergic neurons located in hippocampal regions close to this proliferatively important region [<xref ref-type="bibr" rid="scirp.61173-ref11">11</xref>] . For PACAP and VIP have been discovered direct and indirect neuroprotection via microglia mediated mechanisms (RANTES; CC chemokine Regulated upon Activation, Normal T cell Expressed and Secreted; MIP; macrophage inflammatory protein; ADNF; activity dependent neurotrophic factor) and for PACAP has been discussed a stimulation of chemokine release by microglia for inhibition of gp120 co-repressors like CCR3, CCR5 and CXCR4-a mechanism possibly of relevance for the protection against HIV [<xref ref-type="bibr" rid="scirp.61173-ref26">26</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref70">70</xref>] . High attention has been paid to the presence of VIP in lung and bronchial tissue [<xref ref-type="bibr" rid="scirp.61173-ref71">71</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref73">73</xref>] . A high VIP content in the lung [<xref ref-type="bibr" rid="scirp.61173-ref74">74</xref>] was one of the main triggers of the ligand research on VPAC receptors.</p></sec><sec id="s2_2"><title>2.2. PAC and VPAC Receptors</title><p>Most of the binding data on vasoactive intestinal peptide receptors were measured in cellular systems with overexpression of wild-type and mutated types of the three target receptors. For chicken PAC1 receptors Zawilska et al. [<xref ref-type="bibr" rid="scirp.61173-ref9">9</xref>] ranked the affinities of the endogenous peptides in the following order: PACAP38~PACAP27 &gt; PACAP6-27~PACAP6-38 &gt; chicken VIP (cVIP) &gt; mammalian VIP and secretin (inactive) [<xref ref-type="bibr" rid="scirp.61173-ref9">9</xref>] . The highest density in chicken cortical membranes has been demonstrated with 457 fmol/mg for the PAC1 receptor [<xref ref-type="bibr" rid="scirp.61173-ref9">9</xref>] and in mouse whole brain membranes with 857 fmol/ mg protein [<xref ref-type="bibr" rid="scirp.61173-ref75">75</xref>] using [<sup>125</sup>I]-PACAP27 as receptor ligand. In guinea pig cerebral cortex maximal binding of [<sup>125</sup>I]VIP (human /rat/porcine) was reported by Zawilska et al. 2005 [<xref ref-type="bibr" rid="scirp.61173-ref76">76</xref>] with 77 fmol/mg protein without differentiation of the receptor subtypes and the authors provided relative rank order of potency: cVIP ≥ PACAP38~PACAP27~guinea pig VIP (gpVIP) &gt; mammalian VIP (mVIP) &gt; peptide-histidine-methionine (PHM) &gt; peptide-histidine-isoleucine (PHI) &gt; secretin [<xref ref-type="bibr" rid="scirp.61173-ref76">76</xref>] . Main localizations of PAC1 receptors are neurogenic regions like subventricular zone of olfactory bulb and dentate gyrus [<xref ref-type="bibr" rid="scirp.61173-ref10">10</xref>] . Immunohistochemical investigations suggest high levels of PAC1 receptors also in layer I of the cerebral cortex, very high density of the receptor in hypothalamus, brainstem, midbrain and hindbrain, and in cerebellar nuclei. [<xref ref-type="bibr" rid="scirp.61173-ref57">57</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref58">58</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref77">77</xref>] .</p><p>In turn, PAC1 has been reported to be of less importance in hippocampal regions than VPAC receptors [<xref ref-type="bibr" rid="scirp.61173-ref75">75</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref78">78</xref>] .</p><p>Autoradiographic and membrane binding assay data as well as species differences have been described also for peripheral tissue [<xref ref-type="bibr" rid="scirp.61173-ref12">12</xref>] . Comparison of [<sup>125</sup>I]VIP binding at receptors of the lung in human and guinea pig tissues reveals B<sub>max</sub> values of 11.2 fmol/mg protein and 226 fmol/mg protein, respectively, for the high affinity binding site and 589 fmol/mg protein and 1730 fmol/mg protein at the low affinity binding sites. For the rat lung have been reported B<sub>max</sub> of 584 fmol/mg protein [<xref ref-type="bibr" rid="scirp.61173-ref73">73</xref>] .</p><p>For PAC1 receptors in rodents (PACAP38, K<sub>d</sub> 0.5 nM, for comparison VIP-affinity &gt; 500 nM) have been identified six splice variants relevant for the third intracellular loop which is coupled to G-proteins [<xref ref-type="bibr" rid="scirp.61173-ref79">79</xref>] . The two exons hip and hop, spliced in or out determine different PAC1 receptor variants triggering different signalling pathways [<xref ref-type="bibr" rid="scirp.61173-ref9">9</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref24">24</xref>] . Moreover, splice variants with change in the a.a.r. sequence of the N-ted in position 21 have been described [<xref ref-type="bibr" rid="scirp.61173-ref5">5</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref7">7</xref>] which bind PACAP27, PACAP38 and VIP with similar affinity [<xref ref-type="bibr" rid="scirp.61173-ref5">5</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref7">7</xref>] .</p><p>Activation pathways related to neuroproliferation are regulated via G<sub>q</sub> and G<sub>i</sub> proteins [<xref ref-type="bibr" rid="scirp.61173-ref80">80</xref>] and via interaction with mitogen-activated protein kinase MAP-Kinase and arrestins which provide the regulatory input to receptor internalization, desensitization and proteolytic processes as well as to heteromeric signal protein complex activation. The preferred binding sites of VIP are the N-teds of VPAC1 and VPAC2 receptors (K<sub>D</sub> 1 nM) [<xref ref-type="bibr" rid="scirp.61173-ref81">81</xref>] , which mediate their intracellular actions via G<sub>s</sub> proteins, but also via G<sub>q</sub> and G<sub>o</sub> proteins. They also trigger calcium release as well as interact with RAMP1-3 (receptor activity modifying protein) (cf. <xref ref-type="table" rid="table1">Table 1</xref>). A differentiation between the VPAC receptor subtypes predominantly became possible by the discovery of helodermin obtained from gila monster venom [<xref ref-type="bibr" rid="scirp.61173-ref9">9</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref82">82</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref83">83</xref>] . The peptide shows some homology to PACAP and VIP.</p><p>Whereas Nicole et al. [<xref ref-type="bibr" rid="scirp.61173-ref59">59</xref>] had supplied a first systematic functional classification of VIP and PACAP a.a.r. components, Laburthe et al. (2007) [<xref ref-type="bibr" rid="scirp.61173-ref83">83</xref>] discussed critically basing on these data two different models of the mechanism in which VPAC receptors and especially its N-ted can transfer its endogenous ligands within the transmembrane/juxtamembrane domain (J-domain) of the receptor as well as close to intracellular loops (here IL3) involved in G proteins activation [<xref ref-type="bibr" rid="scirp.61173-ref84">84</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref86">86</xref>] . Endogenous peptide ligands [<xref ref-type="bibr" rid="scirp.61173-ref35">35</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref87">87</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref88">88</xref>] bind by their C-terminal portion to the extracellular domain whereas the N-terminus of the endogenous ligands interacts with the 7TMD structures of the receptors. All Class-B receptors are distinct from Class A receptors by the typically large N-ted (100 - 160 a.a.r, [<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] ) with consensus repeat or Sushi domain core formed by two antiparallel β sheets connected via three disulfide bonds between six cysteine residues and a salt bridge. This feature is regarded as the signature of Class B receptors, even if a full length structure of Class B receptors is yet not available [<xref ref-type="bibr" rid="scirp.61173-ref61">61</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref84">84</xref>] .</p><p>VPAC1 is expressed in lung, small intestine, thymus, kidney and brain [<xref ref-type="bibr" rid="scirp.61173-ref10">10</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref63">63</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref78">78</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref89">89</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref90">90</xref>] . In the brain VPAC receptors are expressed in piriform cortex, cerebral cortex, dentate gyrus, hippocampus, lateral amygdaloid nucleus, caudate putamen, nucleus supraopticus, thalamic nuclei, choroid plexus and pineal gland as well as cerebellar cortex and deep cerebellar nuclei [<xref ref-type="bibr" rid="scirp.61173-ref11">11</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref77">77</xref>] . B<sub>max</sub> values for the binding of [<sup>125</sup>I]cVIP and [<sup>125</sup>I]PACAP have been obtained for chicken hypothalamus and chicken cortical cerebral membranes respectively. [<sup>125</sup>I]cVIP has been shown to bind with 167 fmol/mg protein to chicken hypothalamic membranes [<xref ref-type="bibr" rid="scirp.61173-ref8">8</xref>] ~1/3 of the B<sub>max</sub> for [<sup>125</sup>I] PACAP in cortical cerebral membranes of the same species [<xref ref-type="bibr" rid="scirp.61173-ref9">9</xref>] .</p><p>Also the main target receptors of VIP as there are VPAC1 and VPAC2 have different pharmacology and distributions [<xref ref-type="bibr" rid="scirp.61173-ref5">5</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref91">91</xref>] . E.g. VIP had a 4 fold higher affinity for hVPAC1 than for VPAC2 [<xref ref-type="bibr" rid="scirp.61173-ref60">60</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref61">61</xref>] .</p><p>The VPAC2 receptor is suggested to mediate activation of insulin secretion [<xref ref-type="bibr" rid="scirp.61173-ref91">91</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref92">92</xref>] , while VPAC1 receptors according to their expression pattern are suggested to contribute to the increase of hepatic glucose production [<xref ref-type="bibr" rid="scirp.61173-ref93">93</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref95">95</xref>] but also to attenuation of diabetes related inflammation [<xref ref-type="bibr" rid="scirp.61173-ref96">96</xref>] .</p><p>On the other hand, [<xref ref-type="bibr" rid="scirp.61173-ref24">24</xref>] chromosomal site duplication can result in serious neuroanatomic retardation [<xref ref-type="bibr" rid="scirp.61173-ref24">24</xref>] and characteristic mental diseases, e.g. alterations of VPAC2 expression by chromosomal site duplication can carry the risk of schizophrenia and autism [<xref ref-type="bibr" rid="scirp.61173-ref97">97</xref>] . In turn, VPAC2 receptor-deficient mice showed growth retardation [<xref ref-type="bibr" rid="scirp.61173-ref98">98</xref>] .</p><p>PAC1 knock-out mice have been reported to show mortality close to 60% during the first four weeks after birth. Surviving mice are characterized by a accelerated decrease in social investigations and less aggressively male animals but higher sexual activity. The experiments suggested that PACAP could be a counterpart of the vasopressin-oxytocin system [<xref ref-type="bibr" rid="scirp.61173-ref99">99</xref>] . Furthermore, PAC1 deficient mice were shown to develop reduction of anxiety-like behaviour [<xref ref-type="bibr" rid="scirp.61173-ref100">100</xref>] .</p></sec><sec id="s2_3"><title>2.3. Synthetic Peptide Ligands</title><p>Labelling of synthetic peptide ligands with PET and SPECT isotopes for recognition of VPAC and PAC receptors for diagnostic and therapeutic purposes include <sup>99m</sup>Tc, <sup>18</sup>F, <sup>123</sup>I,<sup> 68</sup>Ga, <sup>64</sup>Cu and <sup>111</sup>In labelled compounds, which are prepared using distinct chelating agents or prosthetic groups [<xref ref-type="bibr" rid="scirp.61173-ref45">45</xref>] . Somatostatin and its labelled analogues (e.g. [<sup>111</sup>In] octreotide) are the most frequently clinically used peptides in tumor diagnostics. However, also further peptide receptor ligands are more and more in the focus of tumor visualization. E.g. bombesin peptides labelled with <sup>18</sup>F and <sup>99m</sup>Tc have been already described in studies with VPAC receptor ligands in the early years of this century. The overexpression of VPAC receptors, however, also in normal tissues of some organs restricts the efficiency of such peptide probes as tools in tumor identification [<xref ref-type="bibr" rid="scirp.61173-ref45">45</xref>] . Other applications e.g. the imaging of brain receptors are limited by vulnerability of the peptides to enzymatic breakdown and low in vitro- stability. Some success could be achieved by reconstituted peptides containing mutations in selected parts of the molecule, intramolecular ring structures, introduction of lactam ringsor acylation of the N-terminus of VIP [<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>] . Furthermore, the connection with polyethylene glycol (PEG) was used to improve the pharmacokinetic properties.</p><sec id="s2_3_1"><title>2.3.1. Peptide Ligands at VPAC1 Receptor</title><p>Nicole et al. (2000) [<xref ref-type="bibr" rid="scirp.61173-ref59">59</xref>] observed, that alanine exchange of VIP a.a.r. in positions 11, 22 and 28 results in binding with 10<sup>-8</sup>M affinity at VPAC1 receptor what is close to the affinity of VIP itself. In contrast, the binding affinity at VPAC2 receptors decreases by one order of magnitude after such substitution. Consequently, [Ala<sup>11,22,28</sup>]VIP is classified as the most selective agonist at human VPAC1 receptor.</p><p>Peptide ligands at VPAC1 receptors (cf. <xref ref-type="table" rid="table2">Table 2</xref>) attract attention predominantly as in vitro probes for the characterization of their target receptors but maintain in part also affinities to VPAC2 and PAC1 receptors. PG 96-238 and PG 97-465 are antagonist and agonist at the VPAC1 receptor, respectively, but also antagonist at VPAC2 and agonists at PAC1 receptor (cf. <xref ref-type="table" rid="table2">Table 2</xref>). PGI 97-278 is partial antagonist at the VPAC1 receptor and agonist at the VPAC2 receptor [<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>] . The extension of the VIP sequences VIP (1 - 24) or VIP (1 - 26) by the carboxyl terminal part of Ro 25-1553 (DLKKGGT or KKGGT) decreased the affinity at VPAC1 receptors but altered not the affinity at VPAC2 receptors.</p></sec><sec id="s2_3_2"><title>2.3.2. Peptide Ligands at VPAC2 Receptor</title><p>For different therapeutic purposes some VIP and PACAP related peptides have been synthesized and shown to</p><table-wrap id="table2" ><label><xref ref-type="table" rid="table2">Table 2</xref></label><caption><title> Some peptide ligands of VPAC1, VPAC2 and PAC1 receptor<sup>*</sup> and their role as agonists or antagonist at these receptors</title></caption><table><tbody><thead><tr><th align="center" valign="middle" >Peptide</th><th align="center" valign="middle" >CAS-no</th><th align="center" valign="middle" >VPAC1R</th><th align="center" valign="middle" >VPAC2R</th><th align="center" valign="middle" >PAC1R</th><th align="center" valign="middle" >References</th></tr></thead><tr><td align="center" valign="middle" >VIP</td><td align="center" valign="middle" >37221-79-7</td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref102">102</xref>]</td></tr><tr><td align="center" valign="middle" >PG-96-237</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>]</td></tr><tr><td align="center" valign="middle" >PG 96-238</td><td align="center" valign="middle" >309728-48-1</td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" >partial agonist</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref95">95</xref>]</td></tr><tr><td align="center" valign="middle" >PG 97-269</td><td align="center" valign="middle" >202463-00-1</td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref103">103</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref104">104</xref>]</td></tr><tr><td align="center" valign="middle" >PG 97-277</td><td align="center" valign="middle" >139308543</td><td align="center" valign="middle" >partial agonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>]</td></tr><tr><td align="center" valign="middle" >PG 97-278</td><td align="center" valign="middle" >1392912-99-0</td><td align="center" valign="middle" >partial antagonist</td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>]</td></tr><tr><td align="center" valign="middle" >PG 99-465</td><td align="center" valign="middle" >309913-26-6</td><td align="center" valign="middle" >fullagonist</td><td align="center" valign="middle" >antagonist partial agonist</td><td align="center" valign="middle" >fullagonist</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref104">104</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref105">105</xref>]</td></tr><tr><td align="center" valign="middle" >Bay 55-9837</td><td align="center" valign="middle" >46390-25-8</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref10">10</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref55">55</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref103">103</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref106">106</xref>]</td></tr><tr><td align="center" valign="middle" >Ro 25-1392</td><td align="center" valign="middle" >150828-75-4</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref107">107</xref>]</td></tr><tr><td align="center" valign="middle" >Ro 25-1553</td><td align="center" valign="middle" >159704-87-6</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref71">71</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref102">102</xref>]</td></tr><tr><td align="center" valign="middle" >[Ala11,22,28]VIP</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref59">59</xref>]</td></tr><tr><td align="center" valign="middle" >PACAP (6-38)</td><td align="center" valign="middle" >143748-18.9</td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref63">63</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref104">104</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref109">109</xref>]</td></tr><tr><td align="center" valign="middle" >M65</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref109">109</xref>]</td></tr><tr><td align="center" valign="middle" >Maxadilan</td><td align="center" valign="middle" >515114-03-1</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref63">63</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref110">110</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref111">111</xref>]</td></tr><tr><td align="center" valign="middle" >Maxadilan d.4</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >antagonist</td><td align="center" valign="middle" ></td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref63">63</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref110">110</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref111">111</xref>]</td></tr><tr><td align="center" valign="middle" >PACAP27</td><td align="center" valign="middle" >129069-75-6</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref109">109</xref>]</td></tr><tr><td align="center" valign="middle" >PACAP38</td><td align="center" valign="middle" >137061-48-4</td><td align="center" valign="middle" ></td><td align="center" valign="middle" ></td><td align="center" valign="middle" >agonist</td><td align="center" valign="middle" >[<xref ref-type="bibr" rid="scirp.61173-ref109">109</xref>]</td></tr></tbody></table></table-wrap><p><sup>*</sup>peptide sequences: VIP: HSDAVFTDNYTRLRKQMAVKKYLNSILN; PG 96-237: AcHSDAVFTENYTKLRKRNleAAKKYLNDLKKGGT; PG 96-238: -FTENYTKL-RKRNleAAKKYLNDLKKGGT (20-16)lactam; PG 97-269: AcHD-PheDAVFTNSYRKVLKRLSARKLLQDIL; PG 97-277: N-Ac-HSDAVFTENYTKLEKRNle-AAKNleYLNNLKKGG-threonine amide; PG 97-278: AcHDPheDAVFTENYTKLRKRNleAAKNleYLNN- LKKGGT; PG 99-465: N-(1-oxotetradecyl) HSDAVFTDNYTKLRKQMAVKKYLNSIKKGGT; Bay 55-9837: HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY; Ro 25-1392: AcHSDAVFTEN-O-methyl-YTKLRKQNleAAKKYLNDLKK(25-21)lactam; Ro 25-1553: AcHSDAVFTENYTKLRKQNleAAKKYLNDLKKGGT;PACAP (6-38): TDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; M65: CDATCQFR-KAIDDCQKQAHHSN-VLLPGNSVFKECMKQKKKEFKAGK; Maxadilan: ATCQFRKAIDDCQKQAHHSNVLQTSVQTTATFTSMDTSQLPGNSVFKECMKQKKKEFKAGK; Maxadilan d.4: CDATCQFRKAIDDCQKQAHHSNV-PGNSVFKECMKQKKKEFKAGK; PACAP27: HSDGIFTDSYSRYRKQMAVKKYLAAVL; PACAP38: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKRYKQRVKNK</p><p>interact with VPAC2 receptors. This is not only limited to tumor diagnostics but include also applications in metabolic diseases. Thus the possibility of a decrease of glucose levels has been investigated. The peptide BAY 55 - 9837 had been identified as an effective glucose suppressing compound by an agonist action via VPAC2 receptors. [<xref ref-type="bibr" rid="scirp.61173-ref16">16</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref106">106</xref>] . However, the compound showed degradation at the N-terminus and deamidation at asparagine [<xref ref-type="bibr" rid="scirp.61173-ref106">106</xref>] . Pan et al. could improve the stability by mutations in the positions 9 and 28 and obtained BAY (Q9Q28) which showed the same affinity at VPAC2 receptors like the original compound. However, it was stable for four weeks at 40˚C, while BAY 55 - 9837 was degradated by 80% within two weeks. Coupling the reconstituted compound via the cysteine residue C32 to polyethylene glycol (22 or 43 kDa) resulted in stable compounds. Best conservation of the in vitro functionality after pegylation was observed with 22 kDA polyethylene glycol. Both pegylated forms were active in vivo, for three and six hours post s.c. injection. General in vivo action was improved and the glucose lowering effect was maintained, while in vitro activities were reduced by pegylation. Mutations in the first a.a.r.s of the N-terminus resulted in reduced flexibility of the ectodomain and consequently a reduced affinity at VPAC2 receptors [<xref ref-type="bibr" rid="scirp.61173-ref106">106</xref>] .</p><p>BAY55-9837 has been proposed recently as a potential protective drug in spinal muscular atrophy in distinct mouse models [<xref ref-type="bibr" rid="scirp.61173-ref112">112</xref>] . Spinal muscular atrophy is a rare disease (incidence 1:11,000) but a leading genetic cause of pediatric death [<xref ref-type="bibr" rid="scirp.61173-ref112">112</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref113">113</xref>] . BAY 55-9837 is presumed to activate via binding at VPAC2 receptors the p38 pathway and to enhance the Survival of Motor Neuron proteins (SMN) type 2 inhibiting the progression of spinal muscular atrophy [<xref ref-type="bibr" rid="scirp.61173-ref108">108</xref>] .</p><p>All the peptide ligands bind orthosterically at the N-terminal ectodomain of their target receptors [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] . But that makes it difficult to develop highly selective ligands for the subtypes of VPAC receptors due to the similarities between the peptides [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] .</p><p>The long-acting VIP analogue Ro 25 - 1553 is a peptide with lactam ring at the amino acids 21 to 25 [<xref ref-type="bibr" rid="scirp.61173-ref95">95</xref>] . The absence of the lactam bridge in the molecule reduced the affinity of the compound at both subtypes of VPAC receptors, but retained a 300 fold selectivity for binding to VPAC2 receptor [<xref ref-type="bibr" rid="scirp.61173-ref94">94</xref>] . This was presumed to be due to charged side chains revealed in these compounds under such conditions. Such consequence could be prevented by introduction of a nor-leucine and an asparagine residue at the positions 21 and 25 [<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>] . Ro 25-1553 was early tested in forebrain membranes [<xref ref-type="bibr" rid="scirp.61173-ref72">72</xref>] where it could displace [<sup>125</sup>I]VIP with an IC<sub>50</sub> of 4.98 nM. The cyclic VIP analogue got especially early attention for its relaxant effect on bronchotracheal tissues in guinea pigs and humans [<xref ref-type="bibr" rid="scirp.61173-ref71">71</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref72">72</xref>] . Since 2003 these effects comparable with that of isoproterenol and salbutamol were confirmed also in clinical studies [<xref ref-type="bibr" rid="scirp.61173-ref114">114</xref>] . The comparison of the influence of Ro 25-1553 on bronchial and lung function with that of salbutamol revealed an equivalent degree of both drugs in protection of pulmonary tissue [<xref ref-type="bibr" rid="scirp.61173-ref70">70</xref>] . In guinea pig and human isolated bronchial tissue Ro25 - 1553 could attenuate brochoconstriction induced by histamine, LTD4, platelet activating factor or acetylcholine [<xref ref-type="bibr" rid="scirp.61173-ref71">71</xref>] . A further cyclic peptide, Ro 25 - 1392, displaced [<sup>125</sup>I] VIP with K<sub>i</sub> of 9.6 and 16 nM at VPAC2 receptors whereas the affinity at VPAC1 receptors was in &#181;M range [<xref ref-type="bibr" rid="scirp.61173-ref17">17</xref>] and only 40% of VPAC receptors the binding sites could be occupied.</p></sec><sec id="s2_3_3"><title>2.3.3. Peptide Ligands at PAC1 Receptor</title><p>For PACAP38 it is known that deletion of the first five a.a.r.s of the peptide transforms it from an agonist to an antagonist at the receptor [<xref ref-type="bibr" rid="scirp.61173-ref58">58</xref>] . Mutational and binding data confirm an essential role of these a.a.r.s in the orthosteric binding of the C-terminus of the endogenous agonist at the N-terminal ectodomain of the receptor and a role of further parts of the peptide in the transfer into vestibular or transmembrane domain of receptor [<xref ref-type="bibr" rid="scirp.61173-ref58">58</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref61">61</xref>] .</p><p>The 61 a.a.r. peptide Maxadilan can be obtained from blood seeking flies as lutzomyia longipalpis [<xref ref-type="bibr" rid="scirp.61173-ref101">101</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref115">115</xref>] but is available today also as synthetic compound. As a vasodilator with higher efficacy than CGRP it plays a role in the infectivity pathway of leishmania conducted by sand fly and does not show close structural similarity to PACAP [<xref ref-type="bibr" rid="scirp.61173-ref111">111</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref116">116</xref>] . Maxadilan acts as an agonist at the PAC1 receptor (<xref ref-type="table" rid="table2">Table 2</xref>). Additionally to the actions on vascular tone of arteriolar vessels recently an enhancement of vascular leakage in postcapillary vessels and venuels has been described accompanied by a stimulation of leucocyte migration via the CXCR1/2 receptor of neutrophils [<xref ref-type="bibr" rid="scirp.61173-ref116">116</xref>] . All these actions are suggested to be mediated via PAC1receptors and can be attenuated by the recombinant analogue of Maxadilan, M65 [<xref ref-type="bibr" rid="scirp.61173-ref116">116</xref>] .</p></sec></sec></sec><sec id="s3"><title>3. Non-Peptide Ligands of VPAC and PAC Receptors</title><p>Until 2010 small molecule ligands had been identified for five of the 15 known Class B GPCRs only [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref117">117</xref>] . Such were antagonists of the CRF1 receptor as SSR125543A, antalarmin, DMP 904, NBI 30775/R121919, NBI 35965; antagonists at the glucagon receptor as LY 168049, BAY 27 - 9955, NNC25 - 2504;, an antagonist at the CGRP receptor: BIBN4096BS; the GLP-1 receptor antagonist T0632 and the calcitonin receptor agonist SUN- B8155 [<xref ref-type="bibr" rid="scirp.61173-ref85">85</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref117">117</xref>] . However, these compounds have been discussed rather as allosteric modulators than as drugs docking orthosterically and acting competitively [<xref ref-type="bibr" rid="scirp.61173-ref117">117</xref>] . Also for the CGRP receptor ligand MK4232, described 2013 by Hostetler et al. [<xref ref-type="bibr" rid="scirp.61173-ref30">30</xref>] , in first successful PET experiments binding modalities in the brain let open questions even if the compound was bound to the parts of the brain in a manner reflecting the regions typically showing high densities of the receptor [<xref ref-type="bibr" rid="scirp.61173-ref118">118</xref>] . The involvement of non-peptide ligands at VPAC and PAC receptors might extend the spectrum of tracers contributing to the characterization of functional basis of mental diseases and of responses to therapeutic interventions in neurological disorders. It is not finally decided which of the recent models [<xref ref-type="bibr" rid="scirp.61173-ref61">61</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref119">119</xref>] for ligand-class C receptor interaction could be a relevant one for the explanation of non-peptide ligand actions.</p><sec id="s3_1"><title>3.1. Non-Peptide VPAC1 Receptor Ligands</title><p>There had been no reports on small molecule non-peptide ligands of the VPAC1 receptor until Harikrishnan et al. (Bristol-Myers Squibb) [<xref ref-type="bibr" rid="scirp.61173-ref90">90</xref>] published 2012 the results of a high throughput screening based on cAMP assays and determination of antiproliferative activity. Three series of potential lead structures were presented providing moderate binding affinities until 81 nM (biaryl compounds; <xref ref-type="fig" rid="fig3">Figure 3</xref>, compounds 1 - 3); 290 nM (cyanothiophenes; <xref ref-type="fig" rid="fig4">Figure 4</xref>, compounds 4 - 8) and 410 nM (cyanothiophene phenethylamide) compounds 9 and 10; <xref ref-type="fig" rid="fig5">Figure 5</xref>).</p><fig id="fig3"  position="float"><label><xref ref-type="fig" rid="fig3">Figure 3</xref></label><caption><title> Non-peptide ligands of VPAC1 receptors: Biaryl compounds: 1. (2,4-di-tert-butyl-6-(4-fluorophenyl) cyclohexyl) methanol; 2. (2,4-di-tert-butyl-6-(4-chlorophenyl) cyclohexyl) methanol; 3. (2,4-die tert-butyl-6-(3,4-dimethylphenyl)-chlo- rophenyl) cyclohexyl) methano. ChemDraw (Cambridgesoft.com) was used for verification of IUPAC names</title></caption><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x8.png"/></fig><fig id="fig4"  position="float"><label><xref ref-type="fig" rid="fig4">Figure 4</xref></label><caption><title> Non-peptide ligands of VPAC1 receptors: Cyanothiopentenes: 4.(E)-N-(3-cyano-4,5,6,7-terahydrobenzo[b] thio- phen-2-yl)acetimidic acid; 5. (E)-N-(3-cyano-4,5,6,7-tera-hydro- benzo-[b]thiophen-2-yl) cyclopentane carbimidic acid; 6. (E)-N-(3-cyano-4,5,6,7-terahydro-benzo[b]thiophen-2-yl) cyclohexane carbimidic acid; 7. (E)-N-(3-cyano-4,5,6,7-terahy- drobenzo[b]thiophen-2-yl) benzimidic acid; 8.(E)-N-(3-cyano-4,5,6,7-terahydrobenzo[b]thiophen-2-yl) acetimidoyl fluoride</title></caption><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x9.png"/></fig><fig id="fig5"  position="float"><label><xref ref-type="fig" rid="fig5">Figure 5</xref></label><caption><title> Non-peptide ligands of VPAC1 receptors: Propanamide substituted cyanothiophenes: 9. N-(3-cyano-4,5,6,7-te- trahydrobenzo [b]thiophe-2-yl)-3-(p-tolyl)propanamide; 10. N-(3-cyano-4,5,6,7-tetrahydrobenzo[b]thiophen-2yl)-3-(4-me- thoxyphenyl)propanamide</title></caption><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x10.png"/></fig><p>Robl et al. provided in 1990 [<xref ref-type="bibr" rid="scirp.61173-ref120">120</xref>] the synthetic route used by Harikrishnan et al. in a modified mode via formation of a lactone and its aromatization followed by introduction of triflic anhydride which gave via aryl triflate finally the biaryl. A series of substitutions at the 2-aryl ring resulted in the best IC<sub>50</sub> values for a 3-chloro compound (100 nM) and a 3,4 dimethyl compound (81 nM) regarding inhibition of cAMP release. Actions on cell proliferation could not be verified.</p><p>The cyanothiophenes stood less active in the same screening assays if various amides had been introduced into the molecules. In general, the introduction of amides coupled to cyclopentyl and hexyl residues resulted in better IC<sub>50</sub> (until 290 nM) than the small aliphatic or small cyclic motifs. Further modification of phenetylamide cyanothiophenes (<xref ref-type="fig" rid="fig5">Figure 5</xref>) could not further improve the inhibitory efficacy in cAMP assays additionally [<xref ref-type="bibr" rid="scirp.61173-ref90">90</xref>] .</p></sec><sec id="s3_2"><title>3.2. Non-Peptide VPAC2 Receptor Ligands</title><p>Neither orthosterically nor allosterically binding small molecule ligands of VPAC2 receptors were presented until 2010 [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] . The first compound discovered by high throughput screening was a nitrophenyl sulfonamide pentanamide which showed moderate IC<sub>50</sub> values for inhibition of VPAC2 receptor-mediated cAMP accumulation (IC<sub>50</sub> 3.8 &#181;M) and for ligand-activated β-arrestin2 binding (IC<sub>50</sub> 2.3 &#181;M; β arrestin Pathhunter assay). Chu et al. (Novartis) pronounciate that only a single lead structure was detected among 1.67 million compounds of their data collection. This compound is a non-competitive ligand of the human VPAC2 receptor [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] (<xref ref-type="fig" rid="fig6">Figure 6</xref>, compound 11).</p><p>One of the main obstacles of the discovery of the small-molecule ligands of class B GPCRs is the absence of highly pecific antagonists at VPAC1 and VPAC2 receptors [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] . Peptide ligands typically bind to orthosteric binding sites of these receptors. However, usually the structural difference between such peptide ligands are not sufficient to discriminate very selectively between the two receptor subtypes. Chu et al. demonstrated for their compound in Schild-Plot analysis of cAMP accumulation typical features of non-competitive ligands as the mismatch of the slope with requirements for perfect linear regression which would have confirmed competitive interaction with the VPAC2 receptor.</p><p>In the β-arrestin assay compound 1 (here compound 11, cf. <xref ref-type="fig" rid="fig6">Figure 6</xref>) decreased EC<sub>50</sub> of VIP but reduced also the maximal level of arrestin binding what fulfills rather the requirements for an allosteric modulator than for a competitive antagonist. The compound interacts with a.a.r. in the TM7 region which are, however, not conserved between human and mouse [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref84">84</xref>] .</p><p>Compound 2 (here compound 12, <xref ref-type="fig" rid="fig6">Figure 6</xref>) is presumed by Chu et al. [<xref ref-type="bibr" rid="scirp.61173-ref47">47</xref>] to activate the VPAC2 receptor rather than to act as an antagonist.</p></sec><sec id="s3_3"><title>3.3. Non-Peptide PAC1 Receptor Ligands</title><p>A first series of small-molecule antagonists of PAC1 receptors with affinities in the nM range was proposed in 2008 by Beebe et al. (Abbott Laboratories) [<xref ref-type="bibr" rid="scirp.61173-ref46">46</xref>] . Hydrazides were chosen as lead structures containing three cyclic moieties and the authors of the study supplied also first landmarks on potential pharmacophore contributions of the essential parts of these compounds [<xref ref-type="bibr" rid="scirp.61173-ref25">25</xref>] . Identification of two lead structures was performed by means of a compound library using [<sup>125</sup>I]PACAP27 binding at PAC1 receptors expressed in human embryonic</p><fig-group id="fig6"><label><xref ref-type="fig" rid="fig6">Figure 6</xref></label><caption><title> Non-peptide ligands of VPAC2 receptors: Pentanamides: 11. (2R, 4S)-2-benzyl-5-((4(tert-butyl)phenyl)sulfona- mido)-4-hydroxy-N-(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1yl)pentanamide; 12. (2R, 4S)-2-benzyl-4-hydroxy-N-(1S, 2R)-2-hydroxy-2,3-dihydro-1H-inden-1yl)5((4-nitrophenyl)sulfonamide)pentanamide.</title></caption><fig id ="fig6_1"><label></label><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x11.png"/></fig><fig id ="fig6_2"><label></label><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x12.png"/></fig></fig-group><p>kidney cells (HEK293f cells). Finally, the structures based on series of alkylidene hydrazides developed by Madsen, Ling et al. (Novo-Nordisk ,Pfizer) as glucagon receptor antagonists in 2002 [<xref ref-type="bibr" rid="scirp.61173-ref121">121</xref>] . Most effective binding potencies at the PAC1 receptor had been observed for a hydrazide (<xref ref-type="fig" rid="fig7">Figure 7</xref>, compound 13) with a K<sub>i</sub> of 56 nM and a hydrazide indole (<xref ref-type="fig" rid="fig7">Figure 7</xref>, compound 16, K<sub>i </sub>72 nM) [<xref ref-type="bibr" rid="scirp.61173-ref25">25</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref46">46</xref>] .</p><p>The log P of compounds 13 and 16 are with 5.36 and 6.12 not in an appropriate range for use as probes for brain imaging. Modifications of the structure with demethylation in the distal ring, at the middle ring and fluorination at the distal ring can bring the ratio closer to 3 (<xref ref-type="fig" rid="fig7">Figure 7</xref>, 15). Beebe et al. [<xref ref-type="bibr" rid="scirp.61173-ref46">46</xref>] revealed in investigations of structure-activity relationships that alterations in these regions will be only of minor consequences for the affinity at the PAC1 receptor.</p><p>Furthermore, the pharmacophore analysis of hydrazide indoles described by Beebe et al. demonstrates the indole moiety tolerates only poor structural modifications. The p-phenol connected by the hydrazide linker with the middle ring as well as its m-electron withdrawing group had been identified to be crucial for high potency of the compound at the target receptor [<xref ref-type="bibr" rid="scirp.61173-ref46">46</xref>] .</p><p>Currently, Wu et al. [<xref ref-type="bibr" rid="scirp.61173-ref25">25</xref>] investigated the potential interaction between the PAC1 receptor and its endogenous ligand PACAP38 as well as with the two hydrazides mentioned above (compounds 13 and 16; <xref ref-type="fig" rid="fig7">Figure 7</xref>). In docking studies of a 3D model of the receptor, the 7TMD of the PAC1 receptor was mimicked by a structure based on homology studies on the PTH1 receptor. The signal sequence of the N-terminal ectodomain (N-ted) had been removed in this model [<xref ref-type="bibr" rid="scirp.61173-ref25">25</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref122">122</xref>] . Previous experiments with exon 2 -/- mice had demonstrated that animals with targeted deletion of the signal peptide are viable, fertile and without morphological differences to wild-type animals [<xref ref-type="bibr" rid="scirp.61173-ref122">122</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref123">123</xref>] . 76 and 89 conformations were identified for the binding of compounds 13 and 16 at the receptor model. In most of them hydrogen bonds were created to the amino acids I63, S100 and G105. Best binding conditions were obtained for compound 13 via hydrogen bonds with S100 and E339. The amino acid residues 116 - 120 of the N-ted domain had been identified as preferred binding sites of PACAP38. Because the signal peptide containing the first 20 amino acids is absent in the model created by Wu et al., the S100 corresponds to S120 in the native receptor [<xref ref-type="bibr" rid="scirp.61173-ref125">125</xref>] . The authors predicted that the investigated hydrazide compounds can inhibit the interaction of PACAP with the N-ted and prevent also the normal conformational consequences for the 7TMD region. They suggested that the compounds produce a steric hindrance for the binding of PACAP and inhibit competitively the biological activity of the peptide ligand.</p><fig id="fig7"  position="float"><label><xref ref-type="fig" rid="fig7">Figure 7</xref></label><caption><title> Non-peptide ligands of PAC1 receptors: Hydrazides and hydrazide indoles: 13. (E)-3-chloro-4-hydroxy-N’-(4- ((4-isopropylbenzyl)oxy)-3,5-dimethoxybenzylidene) benzohydrazide; 14. (E)-3-chloro-4-hydroxy-N’-(3-((4-isopropyl- benzyl)oxy)-4,5-dimethoxybenzylidene) benzohydrazide;15. (E)-3-chloro-N’-(3-((4-fluorobenzyl)oxy) 5-hydroxy-4-me- thoxybenzylidene)-4-hydroxybenzohydrazide; 16. (E)-3-cyano-4-hydroxy-N’((1-(2,3,5,6-tetramethylbenzyl)-1H-indol-4-yl) methylene) benzohydrazide</title></caption><graphic mimetype="image"   position="float"  xlink:type="simple"  xlink:href="http://html.scirp.org/file/8-1390283x13.png"/></fig></sec></sec><sec id="s4"><title>4. Summary and Conclusions</title><p>Already early in vivo PET experiments with potential ligands at Class B receptors of the brain revealed pharmacodynamic constraints for non-peptide ligands in comparison with endogenous peptide ligands of these receptors [<xref ref-type="bibr" rid="scirp.61173-ref27">27</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref123">123</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref124">124</xref>] . E.g. investigations on CRF1 receptors using Br-76 and C-11 labelled compounds resulted in confined ligand binding and receptor occupancy in the brain which was not sufficient for in vivo visualization of regions with enrichment of such receptors.</p><p>Jagoda et al. discussed that related to their 4-[<sup>76</sup>Br] BMK-152 experiments in monkeys [<xref ref-type="bibr" rid="scirp.61173-ref123">123</xref>] , non-peptide, small-molecule ligands would be expected to target the juxtamembrane domain (J-domain) either in allosteric or competitive manner, depending on conformation of the receptor, but at the extracellular domain they were presumed to obey to an allosteric mode only [<xref ref-type="bibr" rid="scirp.61173-ref85">85</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref123">123</xref>] . For instance, antalarmin, a well known CRF1 antagonist, can trigger G<sub>s</sub> or G<sub>i</sub> proteins via binding to different states of the J-domain as preferred target structure [<xref ref-type="bibr" rid="scirp.61173-ref117">117</xref>] . Finally, the action of small-molecule non-peptide ligands is not ensuring the standard behaviour of the models described by Laburthe [<xref ref-type="bibr" rid="scirp.61173-ref84">84</xref>] . Even the most of the small-molecule compounds reported currently are not free of the pharmacodynamic drawbacks preventing high affinity ligand-receptor interactions comparable to that of endogenous peptide ligands.</p><p>Hollenstein (2014) suggested that the problems with small molecules were due to the large cave of the N-ted of Class B receptors which can bind the natural peptides and facilitate their approach to the activation motif in a region surrounded by the transmembrane domains [<xref ref-type="bibr" rid="scirp.61173-ref33">33</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>] . Extracellular domains, especially the N-ted of Class B receptors are regarded to be not well conserved in comparison to Class A receptors, while there is a higher conservation of transmembrane domains (TMD) [<xref ref-type="bibr" rid="scirp.61173-ref125">125</xref>] - [<xref ref-type="bibr" rid="scirp.61173-ref129">129</xref>] . More and more small-molecule ligands are described with their TMD binding sites. For instance, Hollenstein currently described the TM3 domain as a binding site of a CRF1 ligand [<xref ref-type="bibr" rid="scirp.61173-ref33">33</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>] . A further potential target site for receptor probes might be at accessory proteins like RAMPs (cf. <xref ref-type="table" rid="table1">Table 1</xref>) which are colocalized with Class B receptors [<xref ref-type="bibr" rid="scirp.61173-ref42">42</xref>] . For calcitonin gene-re- lated peptide receptors forming a complex with CLR (calcitonin receptor like receptor) and RAMP1 has been shown that the CLR-RAMP1 heterodimer can interact with the small molecule CGRP receptor ligands olcegepant and telcagepant [<xref ref-type="bibr" rid="scirp.61173-ref36">36</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref124">124</xref>] . RAMPs have been shown to be involved also in the actions of CRF1 receptor [<xref ref-type="bibr" rid="scirp.61173-ref38">38</xref>] ; adrenomedullin, amylin, PTH, VPAC and glucagon receptor (cf. <xref ref-type="table" rid="table1">Table 1</xref>). Relations of small molecules to RAMP structures at PAC and VPAC receptors have yet not been investigated. It is known for Class A receptors that allosteric interactions with extracellular loops between transmembrane domains of GPCRs can also influence the cooperativity of the respective domains and finally of the receptors e.g. mAch receptor [<xref ref-type="bibr" rid="scirp.61173-ref127">127</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref130">130</xref>] [<xref ref-type="bibr" rid="scirp.61173-ref131">131</xref>] . Such options could be relevant also in Class B receptors.</p><p>The PAC1 receptor is regarded as the most abundant among the three receptors sensitive to PACAP and VIP. That’s why the confirmation of a competitive binding mode of the hydrazides and hydrazide indoles described by Beebe et al. [<xref ref-type="bibr" rid="scirp.61173-ref46">46</xref>] could be an important step to suitable probes for in vivo imaging.</p><p>However, from the view of pharmacodynamics, the proposed small molecules are yet not able to compete with endogenous peptide ligands. Regarding efforts to use such compounds as PET tracers for in vivo visualization of PAC or VPAC receptors of the brain, they have to be ranged on a pre-stage of preclinical testing at the moment. A pharmacophore model like that developed by Beebe et al. might be a good starting point for the improvement and balanced selection of pharmacodynamically and pharmacokinetically relevant alterations of the molecules. Docking studies as described by Wu et al. [<xref ref-type="bibr" rid="scirp.61173-ref25">25</xref>] support the further improvement of the preliminary lead structures for potential VPAC and PAC receptor ligands and for the selection of best candidates for preclinical characterizations and labelling. Site directed mutations as well as knock-out or transgene animal models [<xref ref-type="bibr" rid="scirp.61173-ref134">134</xref>] will be helpful tools for better understanding of structure-function relationships as well as in evaluation of therapeutic efficacy of potential drugs. But for all of the potential ligands currently available the affinities are beyond the requirements allowing in vivo imaging of neuropeptide receptors. The improvement as well as the characterization of the selectivity for the target receptors of PACAP and VIP and their subtypes remains a challenge.</p></sec><sec id="s5"><title>Acknowledgements</title><p>The author would like to thank Rike Prei&#223; for the excellent technical assistance in the preparation of the manuscript and Ulrich Disko for repeated helpful advice.</p></sec><sec id="s6"><title>Cite this paper</title><p>Margit Pissarek, (2015) Potential PET Ligands for Imaging of Cerebral VPAC and PAC Receptors: Are Non-Peptide Small Molecules Superior to Peptide Compounds?. World Journal of Neuroscience,05,364-384. doi: 10.4236/wjns.2015.55036</p></sec><sec id="s7"><title>Abbreviations</title><p>a.a.r.: amino acid residue;</p><p>ADNF: activity-dependent neurotrophic factor;</p><p>AM: adrenomedullin;</p><p>AMY: amylin;</p><p>CLR: calcitonin receptor-like receptor;</p><p>CT: calcitonin;</p><p>CGRP: calcitonin-gene-related peptide;</p><p>CRF: corticotrophin releasing factor,</p><p>GLP: glucagon-like peptide;</p><p>GPCR: guanine-nucleotide-regulatory-protein-coupled receptor;</p><p>MAP kinase: mitogen-activated protein kinase;</p><p>MIP: macrophage inflammatory protein;</p><p>N-ted: N-terminal ectodomain;</p><p>PACAP: pituitary adenylate cyclase activating polypeptide;</p><p>PAC receptor: pituitary adenylate cyclase activating polypeptide receptor;</p><p>PET: positron emission tomography;</p><p>PHI: peptide-histidine-isoleucine;</p><p>PHM: peptide-histidine-methionin;</p><p>PTH: parathyroid hormone;</p><p>RAMP: receptor activity modifying protein;</p><p>RANTES: CC chemokine Regulated upon Activation, Normal T cell Expressed and Secreted;</p><p>MIP: macrophage inflammatory protein;</p><p>SAR: structure-activity relationships;</p><p>SPECT: single photon emission tomography;</p><p>7TMD: seven transmembrane domains;</p><p>VIP: vasoactive intestinal peptide;</p><p>cVIP: chicken VIP;</p><p>gpVIP: guinea pig VIP;</p><p>mVIP: mammalian VIP;</p><p>VPAC receptor: vasoactive intestinal peptide/pituitary adenylate cyclase activating polypeptide receptor.</p></sec></body><back><ref-list><title>References</title><ref id="scirp.61173-ref1"><label>1</label><mixed-citation publication-type="other" xlink:type="simple">Said, S.I. and Mutt, V. (1970) Polypeptide with Broad Biological Activity: Isolation from Small Intestine. Science, 169, 1217-1218. http://dx.doi.org/10.1126/science.169.3951.1217</mixed-citation></ref><ref id="scirp.61173-ref2"><label>2</label><mixed-citation publication-type="other" xlink:type="simple">Said, S.I. and Mutt, V. (1972) Isolation from Porcine-Intestinal Wall of a Vasoactive Octacosapeptide Related to Secretin and to Glucagon. European Journal of Biochemistry, 28, 199-204. 
http://dx.doi.org/10.1111/j.1432-1033.1972.tb01903.x</mixed-citation></ref><ref id="scirp.61173-ref3"><label>3</label><mixed-citation publication-type="other" xlink:type="simple">Miyata, A., Arimura, A., Dah, R., Minamino, N., Uehara, A., Jiang, L., Culler, M.D. and Coy, D.H. (1989) Isolation of a Novel 38 Residue-Hypothalamic Polypeptide Which Stimulates Adenylate Cyclase in Pituitary Cells. Biochemical and Biophysical Research Communications, 164, 567-574. http://dx.doi.org/10.1016/0006-291X(89)91757-9</mixed-citation></ref><ref id="scirp.61173-ref4"><label>4</label><mixed-citation publication-type="other" xlink:type="simple">Miyata, A., Jiang, L., Dahl, R.D., Kitada, C., Kubo, K., Fujino, M., Minamino, N. and Arimura, A. (1990) Isolation of a Neuropeptide Corresponding to the N-Terminal 27 Residue of the Pituitary Adenylate Cyclase Activating Polypeptide with 38 Residue (PACAP38). Biochemical and Biophysical Research Communications, 170, 643-648. 
http://dx.doi.org/10.1016/0006-291X(90)92140-U</mixed-citation></ref><ref id="scirp.61173-ref5"><label>5</label><mixed-citation publication-type="journal" xlink:type="simple"><name name-style="western"><surname>Harmar</surname><given-names> A.J.</given-names></name>,<name name-style="western"><surname> Arimura</surname><given-names> A.</given-names></name>,<name name-style="western"><surname> Gozes</surname><given-names> I.</given-names></name>,<name name-style="western"><surname> Journot</surname><given-names> L.</given-names></name>,<name name-style="western"><surname> Laburthe</surname><given-names> M.</given-names></name>,<name name-style="western"><surname> Pisegna</surname><given-names> J.R.</given-names></name>,<name name-style="western"><surname> Rawlings</surname><given-names> S.R.</given-names></name>,<name name-style="western"><surname> Robberecht</surname><given-names> P.</given-names></name>,<name name-style="western"><surname> Said</surname><given-names> S.I.</given-names></name>,<name name-style="western"><surname> Sreedharan</surname><given-names> S.P.</given-names></name>,<name name-style="western"><surname> Wank</surname><given-names> S.A. and Waschek J.A. </given-names></name>,<etal>et al</etal>. (<year>1998</year>)<article-title>International Union of Pharmacology. VIII Nomenclature of Receptors for Vasoactive Intestinal Peptides and Pituitary Adenylate Cyclase Activating Polypeptide</article-title><source> Pharmacological Reviews</source><volume> 50</volume>,<fpage> 265</fpage>-<lpage>270</lpage>.<pub-id pub-id-type="doi"></pub-id></mixed-citation></ref><ref id="scirp.61173-ref6"><label>6</label><mixed-citation publication-type="other" xlink:type="simple">Harmar, A.J., Fahrenkrug, J., Gozes, I., Laburthe, M., May, V., Pisegna, J.R., Vaudry, D., Waschek, J.A. and Said, S.I. (2012) Pharmacology and Functions of Receptors for Vasoactive Intestinal Peptide and Pituitary Adenylate Cyclase-Activating Polypeptide: IUPHAR Review 1. British Journal of Pharmacology, 166, 4-17. 
http://dx.doi.org/10.1111/j.1476-5381.2012.01871.x</mixed-citation></ref><ref id="scirp.61173-ref7"><label>7</label><mixed-citation publication-type="other" xlink:type="simple">Harmar, A.J., Marston, H.M., Shen, S., Spratt, C., West, K.M., Sheward, W.J., Morrison, C.F., Dorin, J.R., Piggins, H.D., Reubi, J.C., Kelly, J.S., Maywood, E.S. and Hastings, M.H. (2012) The VPAC2 Receptor Is Essential for Circadian Function in the Mouse Suprachiasmatic Nuclei. Cell, 109, 497-508. 
http://dx.doi.org/10.1016/S0092-8674(02)00736-5</mixed-citation></ref><ref id="scirp.61173-ref8"><label>8</label><mixed-citation publication-type="other" xlink:type="simple">Gonzales, S.M., Kawashima, M., Kamiyoshi, M., Tanaka, K. and Ichinoe, K. (1995) Presence of Vasoactive Intestinal Peptide Receptor in the Hen Hypothalamus. Endocrine Journal, 42, 179-186. http://dx.doi.org/10.1507/endocrj.42.179</mixed-citation></ref><ref id="scirp.61173-ref9"><label>9</label><mixed-citation publication-type="other" xlink:type="simple">Zawilska, J.B., Niewiadomski, P. and Nowak, J.Z. (2003) PAC1 Receptors in Chick Cerebral Cortex: Characterization by Binding of Pituitary Adenylate Cyclase-Activating Polypeptide, [125I]-PACAP27. Neuroscience Letters, 338, 155-158. http://dx.doi.org/10.1016/S0304-3940(02)01397-6</mixed-citation></ref><ref id="scirp.61173-ref10"><label>10</label><mixed-citation publication-type="other" xlink:type="simple">Vaudry, D., Falluel-Morel, A., Bourgault, S., Bassile, M., Burel, D., Wurtz, O., Fournier, A., Chow, B.K.C., Hashimoto, H., Galas, L. and Vaudry, H. (2009) Pituitary Adenylate Cyclase-Activating Polypeptide and Its Receptors: 20 Years after the Discovery. Pharmacological Reviews, 61, 283-357. http://dx.doi.org/10.1124/pr.109.001370</mixed-citation></ref><ref id="scirp.61173-ref11"><label>11</label><mixed-citation publication-type="other" xlink:type="simple">Zaben, M.J. and Gray, W.P. (2013) Neuropeptides and Hippocampal Neurogenesis. Neuropeptides, 47, 431-438. 
http://dx.doi.org/10.1016/j.npep.2013.10.002</mixed-citation></ref><ref id="scirp.61173-ref12"><label>12</label><mixed-citation publication-type="other" xlink:type="simple">Castairs, J.R. and Barnes, P.J. (1986) Visualization of Vasoactive Intestinal Peptide Receptors in Human and Guinea Pig Lung. Journal of Pharmacology and Experimental Therapeutics, 239, 249-255.</mixed-citation></ref><ref id="scirp.61173-ref13"><label>13</label><mixed-citation publication-type="other" xlink:type="simple">Diané, A., Payn, G.W. and Gray, S.L. (2014) Multifaces of Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP): From Neuroprotection and Energy Homeostasis to Respiratory and Cardiovascular Systems. Journal of Metabolic Syndrome, 3, 162. http://dx.doi.org/10.4172/2167-0943.1000162</mixed-citation></ref><ref id="scirp.61173-ref14"><label>14</label><mixed-citation publication-type="other" xlink:type="simple">Nakajima, E., Walkup, R.D., Fuji, A., Shearer, T.R. and Azuma, M. (2013) Pituitary Adenylate Cyclase-Activating Peptide Induces Neurite Outgrowth in Cultured Monkey Trigeminal Ganglion Cells: Involvement of Receptor PAC1. Molecular Vision, 19, 174-183.</mixed-citation></ref><ref id="scirp.61173-ref15"><label>15</label><mixed-citation publication-type="other" xlink:type="simple">Delgado, M. and Ganea, D. (2003) Vasoactive Intestinal Peptide Prevents Activated Microglia-Induced Neurodegeneration under Inflammatory Conditions: Potential Therapeutic Role in Brain Trauma. FASEB Journal, 17, 1922-1924. 
http://dx.doi.org/10.1096/fj.02-1029fje</mixed-citation></ref><ref id="scirp.61173-ref16"><label>16</label><mixed-citation publication-type="other" xlink:type="simple">Tsutsumi, M., Claus, T.H., Liang, Y., Li, Y., Yang, L., Zhu, J., Dela Cruz, F., Peng, X., Chen, H., Yung, S.L., Hamren, S., Livingston, J.N. and Clark, Q.P. (2002) A Potent and Highly Selective VPAC2 Agonist Enhances Glucose-Induced Insulin Release and Glucose Disposal. A Potential Therapy for Type 2 Diabetes. Diabetes, 51, 1453-1460. 
http://dx.doi.org/10.2337/diabetes.51.5.1453</mixed-citation></ref><ref id="scirp.61173-ref17"><label>17</label><mixed-citation publication-type="other" xlink:type="simple">Frechilla, D., Garcia-Osta, A., Palacios, S., Cenarruzabeitia, E. and Del Rio, J. (2011) BDNF Mediates the Neuroprotective Effect of PACAP-38 on Rat Cortical Neurons. Neuroreport, 12, 919-923. 
http://dx.doi.org/10.1097/00001756-200104170-00011</mixed-citation></ref><ref id="scirp.61173-ref18"><label>18</label><mixed-citation publication-type="other" xlink:type="simple">Couvineau, A., Ceraudo, E., Tan, Y.-V., Nicole, P. and Laburthe, M. (2012) The VPAC1 Receptor: Structure and Function of a Class B GPCR Prototype. Frontiers in Endocrinology, 3, 139. 
http://dx.doi.org/10.3389/fendo.2012.00139</mixed-citation></ref><ref id="scirp.61173-ref19"><label>19</label><mixed-citation publication-type="other" xlink:type="simple">Otto, C., Hein, L., Brede, M., Jahns, R., Engelhardt, S., Grone, H.-J. and Schütz, G. (2004) Pulmonary Hypertension and Right Heart Failure in Pituitary Adenylate Cyclase-Activating Polypeptide Type 1 Receptor Deficient Mice. Circulation, 110, 3245-3251. http://dx.doi.org/10.1161/01.CIR.0000147235.53360.59</mixed-citation></ref><ref id="scirp.61173-ref20"><label>20</label><mixed-citation publication-type="other" xlink:type="simple">Faraone, S.V., Skol, A.D., Tsuang, D.W., Young, K.A., Haverstock, S.L., Prabhudesai, S., Mena, F., Menon, A.S., Leong, L., Sautter, F., Baldwin, C., Bingham, S., Weiss, D., Collins, J., Keith, T., Vanden Eng, J.L., Boehnke, M., Tsuang, M.T. and Schellenberg, G.D. (2005) Genome Scan of Schizophrenia Families in a Large Veterans Affairs Cooperative Study Sample: Evidence for Linkage to 18p11.32 and for Racial Heterogeneity on Chromosomes 6 and 14. American Journal of Medical Genetics Part B: Neuropsychiatric Genetics, 139B, 91-100. 
http://dx.doi.org/10.1002/ajmg.b.30213</mixed-citation></ref><ref id="scirp.61173-ref21"><label>21</label><mixed-citation publication-type="other" xlink:type="simple">Hashimoto, R., Hashimoto, H., Shintani, N., Chiba, S., Hattori, S., Okada, T., Nakajima, M, Tanaka, K., Kawagishi, N., Nemoto, K., Mori, T., Onishi, T., Noguchi, H., Hori, H., Suzuki, T., Iwata, N., Ozaki, N., Nakabayashi, T., Saitoh, O., Kosuga, A., Tatsumi, M., Kamijima, K., Weinberger, D.R., Kunugi, H. and Baba, A. (2007) Pituitary Adenylate Cyclase Activating Polypeptide Is Associated with Schizophrenia. Molecular Psychiatry, 12, 1026-1032. 
http://dx.doi.org/10.1038/sj.mp.4001982</mixed-citation></ref><ref id="scirp.61173-ref22"><label>22</label><mixed-citation publication-type="other" xlink:type="simple">Vaudry, D., Gonzalez, B.J., Basille, M., Yon, A., Fournier, A. and Vaudry, H. (2000) Pituitary Adenylate Cyclase-Activating Polypeptide and Its Receptors: From Structure to Functions. Pharmacological Reviews, 52, 269-324.</mixed-citation></ref><ref id="scirp.61173-ref23"><label>23</label><mixed-citation publication-type="other" xlink:type="simple">Kumar, S., Pioszak, A., Zhang, C., Swaminathan, K. and Xu, H.E. (2011) Crystal Structure of the PAC1R Extracellular Domain Unifies a Consensus Fold for Hormone Recognition by Class B G-Protein Coupled Receptors. PLoS ONE, 6, e19682. http://dx.doi.org/10.1371/journal.pone.0019682</mixed-citation></ref><ref id="scirp.61173-ref24"><label>24</label><mixed-citation publication-type="other" xlink:type="simple">Shen, S, Gehlert, D.R. and Collier, D.A. (2013) PACAP and PAC1 Receptor in Brain Development and Behavior. Neuropeptides, 47, 421-430. http://dx.doi.org/10.1016/j.npep.2013.10.005</mixed-citation></ref><ref id="scirp.61173-ref25"><label>25</label><mixed-citation publication-type="other" xlink:type="simple">Wu, L., Guang, W., Chen, X. and Hong, A. (2014) Homology Modeling and Molecular Docking of Human Pituitary Adenylate Cyclase-Activating Polypeptide I Receptor. Molecular Medicine Reports, 10, 1691-1696. 
http://dx.doi.org/10.3892/mmr.2014.2419</mixed-citation></ref><ref id="scirp.61173-ref26"><label>26</label><mixed-citation publication-type="other" xlink:type="simple">Dejda, A., Sokolowska, P. and Nowak, J.Z. (2005) Neuroprotective Potential of Three Neuropeptides. Pharmacological Reports, 57, 307-320.</mixed-citation></ref><ref id="scirp.61173-ref27"><label>27</label><mixed-citation publication-type="other" xlink:type="simple">Sullivan, G.M., Parsey, R.V., Kumar, J.S.D., Arango, V., Kassir, S.A., Huang, Y.-Y., Simpson, N.R., van Heertum, R.L. and Mann, J.J. (2007) PET Imaging of CRF1 with [11C]R121919 and [11C]DMP696: Is the Target of Sufficient Density? Nuclear Medicine and Biology, 34, 353-361. http://dx.doi.org/10.1016/j.nucmedbio.2007.01.012</mixed-citation></ref><ref id="scirp.61173-ref28"><label>28</label><mixed-citation publication-type="other" xlink:type="simple">Zorilla, E.P. and Koob, G.F. (2010) Progress in Corticotrophin Releasing Factor 1 Antagonist Development. Drug Discovery Today, 15, 371-383. http://dx.doi.org/10.1016/j.drudis.2010.02.011</mixed-citation></ref><ref id="scirp.61173-ref29"><label>29</label><mixed-citation publication-type="other" xlink:type="simple">Kehne, J.H. and Cain, C.K. (2010) Therapeutic Utility of Non-Peptidic CRF1 Receptor Antagonists in Anxiety, Depression and Stress-Related Disorders: Evidence from Animal Models. Pharmacology &amp; Therapeutics, 128, 460-487. 
http://dx.doi.org/10.1016/j.pharmthera.2010.08.011</mixed-citation></ref><ref id="scirp.61173-ref30"><label>30</label><mixed-citation publication-type="other" xlink:type="simple">Hostetler, E.D., Joshi, A.D., Sanabria-Bohorquez, S., Fan, H., Zeng, Z., Purcell, M., Gantert, L., Riffel, K., William, M., O’Malley, S., Miller, P., Selnick, H.G., Gallicchio, S.N., Bell, I.M., Salvatore, C., Kane, S.A., Li, C.C., Hargreaves, R., de Groot, T., Bormans, G., van Hecken, A., Derdelinckx, I., de Hoon, J., Reynders, T., Declercq, R., de Lepeleire, I., Kennedy, W.D., Blanchard, R., Marcantonio, E.E., Sur, C., Cook, J.J., van Laere, K. and Evelhoch, J.L. (2013) In Vivo Quantification of Calcitonin Gene-Related Peptide Receptor Occupancy by Telcagepant in Rhesus Monkey and Human Brain Using the Positron Emission Tomography Tracer [11C]MK-4232. Journal of Pharmacology and Experimental Pharmaceutics, 347, 478-486. http://dx.doi.org/10.1124/jpet.113.206458</mixed-citation></ref><ref id="scirp.61173-ref31"><label>31</label><mixed-citation publication-type="other" xlink:type="simple">Shoichet, B.K. and Kobilka, B.K. (2012) Structure-Based Drug Screening for G-Protein-Coupled Receptors. Trends in Pharmacological Sciences, 33, 268-272. http://dx.doi.org/10.1016/j.tips.2012.03.007</mixed-citation></ref><ref id="scirp.61173-ref32"><label>32</label><mixed-citation publication-type="other" xlink:type="simple">Hausch, F. (2013) Structures of Class B G Protein-Coupled Receptors: Prospects for Drug Discovery. Angewandte Chemie International Edition, 52, 12783-12785. http://dx.doi.org/10.1002/anie.201307542</mixed-citation></ref><ref id="scirp.61173-ref33"><label>33</label><mixed-citation publication-type="other" xlink:type="simple">Hollenstein, K., Kean, J., Bortolato, A., Cheng, R.K.Y., Dore, A.S., Jazayeri, A., Cooke, R.M., Weir, M. and Marshall, F.H. (2013) Structure of Class B GPCR Corticotropin Releasing Factor Receptor 1. Nature, 499, 438-443. 
http://dx.doi.org/10.1038/nature12357</mixed-citation></ref><ref id="scirp.61173-ref34"><label>34</label><mixed-citation publication-type="other" xlink:type="simple">Siu, F.Y., de Graaf, C., Han, G.W., Yang, D., Zhang, Z., Zhou, C., Xu, Q., Wacker, D., Joseph, J.S., Liu, W., Lau, J., Cherezov, V., Katritch, V., Wang, M.-W. and Stevens, R.C. (2013) Structure of the Human Glucagon Class B G-Protein-Coupled Receptor. Nature, 499, 444-451. http://dx.doi.org/10.1038/nature12393</mixed-citation></ref><ref id="scirp.61173-ref35"><label>35</label><mixed-citation publication-type="other" xlink:type="simple">Siu, F.Y. and Stevens, R.C. (2010) RAMP-ing up Class B GPCR ECD Structural Coverage. Structure, 18, 1067-1068. 
http://dx.doi.org/10.1016/j.str.2010.08.004</mixed-citation></ref><ref id="scirp.61173-ref36"><label>36</label><mixed-citation publication-type="other" xlink:type="simple">Hollenstein, K., de Graaf, C., Bortolato, A., Wang, M.-W., Marshall, F.H. and Stevens, R.C. (2014) Insights into Structure of Class B GPCRs. Trends in Pharmacological Sciences, 35, 12-22. 
http://dx.doi.org/10.1016/j.tips.2013.11.001</mixed-citation></ref><ref id="scirp.61173-ref37"><label>37</label><mixed-citation publication-type="other" xlink:type="simple">Bortolato, A., Dore, A.S., Hollenstein, K., Tehan, B.G., Mason, J.S. and Marshall, F.H. (2014) Structure of Class B GPCRS: New Horizons for Drug Discovery. British Journal of Pharmacology, 171, 3132-3145. 
http://dx.doi.org/10.1111/bph.12689</mixed-citation></ref><ref id="scirp.61173-ref38"><label>38</label><mixed-citation publication-type="other" xlink:type="simple">Wootten, D., Lindmark, H., Kadmiel, M., Willcockson, H., Caron, K.M., Barwell, J., Drmota, T. and Poyner, D.R. (2013) Receptor Activity Modifying Proteins (RAMPS) Interact with the VPAC2 Receptor and CRF1 Receptors and Modulate Their Function. British Journal of Pharmacology, 168, 822-834. 
http://dx.doi.org/10.1111/j.1476-5381.2012.02202.x</mixed-citation></ref><ref id="scirp.61173-ref39"><label>39</label><mixed-citation publication-type="other" xlink:type="simple">Archbold, J.K., Flanagan, J.U., Watkins, H.A., Gingell, J.J. and Hay, D.L. (2011) Structural Insights into RAMP Modification of Secretin Family G Protein-Coupled Receptors: Implications for Drug Development. Trends in Pharmacological Sciences, 32, 591-600. http://dx.doi.org/10.1016/j.tips.2011.05.007</mixed-citation></ref><ref id="scirp.61173-ref40"><label>40</label><mixed-citation publication-type="other" xlink:type="simple">Christopoulos, A., Christopoulos, G., Morfis, M., Udawela, M., Laburthe, M., Couvineau, A., Kuwasako, K., Tilakaratne, N. and Sexton, P.M. (2003) Novel Receptor Partners and Function of Receptor Activity-Modifying Proteins. Journal of Biological Chemistry, 278, 3293-3297. http://dx.doi.org/10.1074/jbc.C200629200</mixed-citation></ref><ref id="scirp.61173-ref41"><label>41</label><mixed-citation publication-type="other" xlink:type="simple">Roux, B.T. and Cottrell, G.S. (2014) G Protein-Coupled Receptors: What a Difference a “Partner” Makes. International Journal of Molecular Sciences, 15, 1112-1142. http://dx.doi.org/10.3390/ijms15011112</mixed-citation></ref><ref id="scirp.61173-ref42"><label>42</label><mixed-citation publication-type="other" xlink:type="simple">Foord, S.M. and Marshall, F.H. (1999) RAMPS: Accessory Proteins for Seven Transmembrane Domain Receptors. Trends in Pharmacological Sciences, 20, 184-187. http://dx.doi.org/10.1016/s0165-6147(99)01347-4</mixed-citation></ref><ref id="scirp.61173-ref43"><label>43</label><mixed-citation publication-type="other" xlink:type="simple">Moore, E.L., Gingell, J.J., Kane, S.A., Hay, D.L. and Salvatore, C.A. (2010) Mapping the CGRP Receptor Ligand Binding Domain: Tryptophan-84 of RAMP1 Is Critical for Agonist and Antagonist Binding. Biochemical and Biophysical Research Communications, 394, 141-145. http://dx.doi.org/10.1016/j.bbrc.2010.02.131</mixed-citation></ref><ref id="scirp.61173-ref44"><label>44</label><mixed-citation publication-type="other" xlink:type="simple">Schottelius, M. and Wester, H.-J. (2009) Molecular Imaging Targeting Peptide Receptors. Methods, 48, 161-177. 
http://dx.doi.org/10.1016/j.ymeth.2009.03.012</mixed-citation></ref><ref id="scirp.61173-ref45"><label>45</label><mixed-citation publication-type="other" xlink:type="simple">Fani, M., Maecke, H.R. and Okarvi, S.M. (2012) Radiolabelled Peptides: Valuable Tools for the Detection and Treatment of Cancer. Theranostics, 2, 481-501. http://dx.doi.org/10.7150/thno.4024</mixed-citation></ref><ref id="scirp.61173-ref46"><label>46</label><mixed-citation publication-type="other" xlink:type="simple">Beebe, X., Darzak, D., Rachel, A., Davis-Taber, R.A., Uchic, M.E., Scott, V.E., Jarvis, M.F. and Stewart, A.O. (2008) Discovery and SAR of Hydrazide Antagonists of the Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) Receptor Type 1 (PAC1-R). Bioorganic and Medicinal Chemical Letters, 18, 2162-2166. 
http://dx.doi.org/10.1016/j.bmcl.2008.01.052</mixed-citation></ref><ref id="scirp.61173-ref47"><label>47</label><mixed-citation publication-type="other" xlink:type="simple">Chu, A., Caldwel, J.S. and Chen, Y.C. (2010) Identification and Characterization of a Small Molecule Antagonist of Human VPAC2 Receptor. Molecular Pharmacology, 77, 95-101. http://dx.doi.org/10.1124/mol.109.060137</mixed-citation></ref><ref id="scirp.61173-ref48"><label>48</label><mixed-citation publication-type="other" xlink:type="simple">Neumann, J.M., Couvineau, A., Murail, S., Lacapère, J.J., Jamin, N. and Laburthe, M. (2008) Class-B GPCR Activation: Is Ligand Helix-Capping the Key? Trends in Biochemical Sciences, 33, 314-319. 
http://dx.doi.org/10.1016/j.tibs.2008.05.001</mixed-citation></ref><ref id="scirp.61173-ref49"><label>49</label><mixed-citation publication-type="other" xlink:type="simple">Watkins, H.A., Au, M. and Hay, D.L. (2012) The Structure of Secretin Family GPCR Peptide Ligands: Implications for Receptor Pharmacology and Drug Development. Drug Discovery Today, 17, 1006-1014. 
http://dx.doi.org/10.1016/j.drudis.2012.05.005</mixed-citation></ref><ref id="scirp.61173-ref50"><label>50</label><mixed-citation publication-type="other" xlink:type="simple">Lee, E.H. and Seo, S.R. (2014) Neuroprotective Roles of Pituitary Adenylate Cyclase-Activating Polypeptide in Neurodegenerative Diseases. BMB Reports, 47, 369-375. http://dx.doi.org/10.5483/BMBRep.2014.47.7.086</mixed-citation></ref><ref id="scirp.61173-ref51"><label>51</label><mixed-citation publication-type="other" xlink:type="simple">Mayo, K.E., Miller, L.J., Bataille, D., Dalle, S., Goke, B., Thorens, B. and Drucker, D.J. (2003) International Union of Pharmacology: XXXV. The Glucagon Receptor Family. Pharmacological Reviews, 55, 165-194. 
http://dx.doi.org/10.1124/pr.55.1.6</mixed-citation></ref><ref id="scirp.61173-ref52"><label>52</label><mixed-citation publication-type="other" xlink:type="simple">Will-Shahab, L., Wallukat, G. and Küttner, I. (1992) G Protein-Coupled PACAP Receptors in Cardiac Sarcolemmal Membranes. Journal of Molecular Cellular Cardiology, 24, S22. http://dx.doi.org/10.1016/0022-2828(92)91574-O</mixed-citation></ref><ref id="scirp.61173-ref53"><label>53</label><mixed-citation publication-type="other" xlink:type="simple">Scaldaffieri, M.L., Modesti, A., Palumbo, C., Ulisse, S., Fabbri, A., Picione, E., Frajese, G. and Moretti, C. (2000) Pituitary Adenylate Cyclase Activating Polypeptide and PACAP-Receptor Type 1 Expression in Rat and Human Placenta. Endocrinology, 141, 1158-1167. http://dx.doi.org/10.1210/endo.141.3.7346 
http://dx.doi.org/10.1210/en.141.3.1158</mixed-citation></ref><ref id="scirp.61173-ref54"><label>54</label><mixed-citation publication-type="other" xlink:type="simple">Colwell, C.S., Michel, S., Itri, J., Rodriguez, W., Tam, J., Lelievre, V., Hu, Z. and Waschek, J.A. (2004) Selective Deficits in the Circadian Light Response in Mice Lacking PACAP. American Journal of Physiology, Regulatory, Integrative and Comparative Physiology, 287, 1194-1201. http://dx.doi.org/10.1152/ajpregu.00268.2004</mixed-citation></ref><ref id="scirp.61173-ref55"><label>55</label><mixed-citation publication-type="other" xlink:type="simple">Pantazopoulos, H., Dolatshad, H. and Davis, F.C. (2010) Chronic Stimulation of the Hypothalamic Vasoactive Intestinal Peptide Receptor Lengthen Circadian Period in Mice and Hamsters. American Journal of Physiology, Regulatory, Integrative and Comparative Physiology, 299, R379-R385. http://dx.doi.org/10.1152/ajpregu.00176.2010</mixed-citation></ref><ref id="scirp.61173-ref56"><label>56</label><mixed-citation publication-type="other" xlink:type="simple">Girard, B.A., Lelievre, V., Braas, K.M., Razinia, T., Vizzard, M.A., Ioffe, Y., El Meskini, R., Ronnett, G.V., Waschek, J.A. and May, V. (2006) Noncompensation in Peptide/Receptor Gene Expression and Distinct Behavioral Phenotypes in VIP and PACAP Deficient Mice. Journal of Neurochemistry, 99, 499-513. 
http://dx.doi.org/10.1111/j.1471-4159.2006.04112.x</mixed-citation></ref><ref id="scirp.61173-ref57"><label>57</label><mixed-citation publication-type="other" xlink:type="simple">Jaworski, D.M. and Proctor, M.D. (2000) Developmental Regulation of Pituitary Adenylate Cyclase-Activating Polypeptide and PAC1 Receptor mRNA Expression in the Rat Central Nervous System. Developmental Brain Research, 120, 27-39. http://dx.doi.org/10.1016/S0165-3806(99)00192-3</mixed-citation></ref><ref id="scirp.61173-ref58"><label>58</label><mixed-citation publication-type="other" xlink:type="simple">Sun, C., Song, D., Davis-Taber, R.A., Barrett, L.W., Scott, V.E., Richardson, P.L., Pereda-Lopez, A., Uchic, M.E., Solomon, L.R., Lake, M.R., Walter, K.A., Hajduk, P.J. and Olejniczak, E.T. (2007) Solution Structure and Mutational Analysis of Pituitary Adenylate Cyclase-Activating Polypeptide Binding to the Extracellular Domain of PAC1-Rs. Proceedings of the National Academy of Sciences, 104, 7875-7880. http://dx.doi.org/10.1073/pnas.0611397104</mixed-citation></ref><ref id="scirp.61173-ref59"><label>59</label><mixed-citation publication-type="other" xlink:type="simple">Nicole, P., Lins, L., Rouyer-Fessard, C., Drouot, C., Fulcrand, P., Thomas, A., Couvineau, A., Martinez, J., Brasseur, R. and Laburthe, M. (2000) Identification of Key Residue for Interaction of Vasoactive Intestina Peptide with Human VPAC1 and VPAC2 Receptors and Development of Highly Selective VPAC1 Receptor Agonist. Journal of Biological Chemistry, 275, 24003-24012. http://dx.doi.org/10.1074/jbc.M002325200</mixed-citation></ref><ref id="scirp.61173-ref60"><label>60</label><mixed-citation publication-type="other" xlink:type="simple">Igarashi, H., Ito, T., Pradhan, T.K., Mantey, S.A., Hou, W., Coy, D.H. and Jensen R.T. (2002) Elucidation of the Vasoactive Intestinal Peptide Pharmacophore for VPAC2 Receptors in Human and Rat Comparison to the Pharmacophore for VPAC1 Receptors. Journal of Pharmacology and Experimental Therapeutics, 303, 445-460. 
http://dx.doi.org/10.1124/jpet.102.038075</mixed-citation></ref><ref id="scirp.61173-ref61"><label>61</label><mixed-citation publication-type="other" xlink:type="simple">Laburthe, M., Couvineau, A. and Marie, J.C. (2002) Molecular Pharmacology and Structure of VPAC Receptors for VIP and PACAP. Receptor Channels, 108, 137-153. http://dx.doi.org/10.1080/10606820213680</mixed-citation></ref><ref id="scirp.61173-ref62"><label>62</label><mixed-citation publication-type="other" xlink:type="simple">Igarashi, H., Ito, T., Mantey, S.A., Pradhan, T.K., Hou, W., Coy, D.H. and Jensen, R.T. (2005) Development of Simplified Vasoactive Intestinal Peptide Analogs with Receptor Selectivity and Stability for Human Vasoactive Intestinal Peptide/Pituitary Adenylate Cyclase-Activating Polypeptide Receptors. Journal of Pharmacology and Experimental Therapeutics, 315, 370-381. http://dx.doi.org/10.1124/jpet.105.088823</mixed-citation></ref><ref id="scirp.61173-ref63"><label>63</label><mixed-citation publication-type="other" xlink:type="simple">Dickson, L. and Finlayson, K. (2009) VPAC and PAC Receptors: From Ligands to Function. Pharmacology &amp; Therapeutics, 121, 294-316. http://dx.doi.org/10.1016/j.pharmthera.2008.11.006</mixed-citation></ref><ref id="scirp.61173-ref64"><label>64</label><mixed-citation publication-type="other" xlink:type="simple">Yadav, M., Huang, M.-C. and Goetzl, E.J. (2011) VPAC1 (Vasoactive Intestinal Peptide (VIP) Receptor Type 1) G Protein Coupled Receptor Mediation of VIP Enhancement of Murine Experimental Colitis. Cellular Immunology, 267, 124-132. http://dx.doi.org/10.1016/j.cellimm.2011.01.001</mixed-citation></ref><ref id="scirp.61173-ref65"><label>65</label><mixed-citation publication-type="other" xlink:type="simple">Ma, B.-Q., Zhang, M. and Ba, L. (2015) Plasma Pituitary Adenylate Cyclase-Activating Polypeptide Concentrations and Mortality after Acute Spontaneous Basal Ganglia Hemorrhage. Clinica Chimica Acta, 439, 102-106. 
http://dx.doi.org/10.1016/j.cca.2014.10.010</mixed-citation></ref><ref id="scirp.61173-ref66"><label>66</label><mixed-citation publication-type="other" xlink:type="simple">Lin, C.-H., Chiu, L., Lee, H.-T., Chiang, C.-W., Liu, S.-P., Hsu, Y.-H., Lin, S.-Z., Hsu, C.-Y., Hsieh, C.-H. and Shyu, W.-C. (2015) PACAP38/PAC1 Signaling Induces Bone Marrow-Derived Cells Homing to Ischemic Brain. Stem Cells, 33, 1153-1172. http://dx.doi.org/10.1002/stem.1915</mixed-citation></ref><ref id="scirp.61173-ref67"><label>67</label><mixed-citation publication-type="other" xlink:type="simple">Ressler, K.J., Mercer, K.B., Bradley, B., Jovanovic, T., Mahan, A., Kerley, K., Norrholm, S.D., Kilaru, V., Smith, A.K., Myers, A.J., Ramirez, M., Engel, A., Hammack, S.E., Toufexis, D., Braas, K.M., Binder, E.B. and May, V. (2011) Post-Traumatic Stress Disorder Is Associated with PACAP and PAC1 Receptor. Nature, 470, 492-497. 
http://dx.doi.org/10.1038/nature09856</mixed-citation></ref><ref id="scirp.61173-ref68"><label>68</label><mixed-citation publication-type="other" xlink:type="simple">Igarashi, H., Fujimori, N., Ito, T., Nakamura, T., Oono, T., Nakamura, K., Suzuki, K., Jensen, R.T. and Takayanagi, R. (2011) Vasoactive Intestinal Peptide (VIP) Receptor-Elucidation of Structure and Function for Therapeutic Applications. International Journal of Clinical Medicine, 2, 500-508. http://dx.doi.org/10.4236/ijcm.2011.24084</mixed-citation></ref><ref id="scirp.61173-ref69"><label>69</label><mixed-citation publication-type="other" xlink:type="simple">Baranowska, B., Radzikowska, M., Wasilewska-Dziubinska, E., Roguski, K. and Borowiec, M. (2000) Disturbed Release of Gastrointestinal Peptides in Anorexia Nervosa and Obesity. Diabetes, Obesity and Metabolism, 2, 99-103. 
http://dx.doi.org/10.1046/j.1463-1326.2000.00070.x</mixed-citation></ref><ref id="scirp.61173-ref70"><label>70</label><mixed-citation publication-type="other" xlink:type="simple">Ohtaki, H., Nakamachi, T., Dogi, K., Aizawa, Y., Takaki, A., Hodoyama, K., Yofu, S., Hashimoto, H., Shintani, N., Baba, A., Kopf, M., Iwakura, M., Arimura, A. and Shioda, S. (2006) Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) Decreases Ischemic Neuronal Cell Death in Association with IL-6. Proceedings of the National Academy of Sciences, 103, 7488-7493. http://dx.doi.org/10.1073/pnas.0600375103</mixed-citation></ref><ref id="scirp.61173-ref71"><label>71</label><mixed-citation publication-type="other" xlink:type="simple">O’Donnell, M., Garippa, R.J., Rinaldi, N., Selig, W.M., Simko, B., Renzetti, L., Tannu, S.A., Wassermann, M.A., Welton, A. and Bolin, D.R. (1994) Ro 25-1553: A Novel, Long-Acting Vasoactive Intestinal Peptide Agonist. Part I: In Vitro and in Vivo Bronchodilator Studies. Journal of Pharmacology and Experimental Therapeutics, 270, 1282-1288.</mixed-citation></ref><ref id="scirp.61173-ref72"><label>72</label><mixed-citation publication-type="other" xlink:type="simple">O’Donnell, M., Garippa, R.J., Rinald, I.N., Selig, W.M., Tocker, J.E., Tannu, S.A., Wasserman, M.A., Welton, A. and Bolin, D.R. (1994) RO 25-1553: A Novel, Long-Acting Vasoactive Intestinal Peptide Agonist. Part II: Effect on in Vitro and in Vivo Models of Pulmonary Anaphylaxis. Journal of Pharmacology and Experimental Therapeutics, 270, 1289-1294.</mixed-citation></ref><ref id="scirp.61173-ref73"><label>73</label><mixed-citation publication-type="other" xlink:type="simple">Leroux, P., Vaudry, H., Fournier, A., St-Pierre, S. and Pelletier, G. (1984) Characterization and Localization of Vasoactive Intestinal Peptide Receptors in the Rat Lung. Endocrinology, 114, 1506-1512. 
http://dx.doi.org/10.1210/endo-114-5-1506</mixed-citation></ref><ref id="scirp.61173-ref74"><label>74</label><mixed-citation publication-type="other" xlink:type="simple">Polak, J.M. and Bloom, S.R. (1982) Occurrence and Distribution of Regulatory Peptides in the Respiratory Tract. Experimental Lung Research, 3, 313-328. http://dx.doi.org/10.3109/01902148209069660</mixed-citation></ref><ref id="scirp.61173-ref75"><label>75</label><mixed-citation publication-type="other" xlink:type="simple">Hashimoto, H., Shintani, N., Nishino, A., Okabe, M., Ikawa, M., Matsuyama, S., Itoh, K., Yamamoto, K., Tomimoto, S., Fujit, A.T., Hagihara, N., Mori, W., Koyama, Y., Matsuda, T., Nagata, S. and Baba, A. (2000) Mice with Markedly Reduced PACAP (PAC1) Receptor Expression by Targeted Deletion of the Signal Peptide. Journal of Neurochemistry, 75, 1810-1817. http://dx.doi.org/10.1046/j.1471-4159.2000.0751810.x</mixed-citation></ref><ref id="scirp.61173-ref76"><label>76</label><mixed-citation publication-type="other" xlink:type="simple">Zawilska, J.B., Dejda, A., Niewiadomski, P., Gozes, I. and Nowak, J.Z. (2005) Receptors for VIP and PACAP in Guinea Pig Cerebral Cortex. Effects on Cyclic AMP Synthesis and Characterization by 125I-VIP Binding. Journal of Molecular Neuroscience, 25, 215-224. http://dx.doi.org/10.1385/JMN:25:3:215</mixed-citation></ref><ref id="scirp.61173-ref77"><label>77</label><mixed-citation publication-type="other" xlink:type="simple">Joo, K.M., Chung, Y.H., Kim, M.K., Nam, R.H., Lee, B.L. and Cha, C.I. (2004) Distribution of Vasoactive Intestinal Peptide and Pituitary Adenylate Cyclase-Activating Polypeptide Receptors (VPAC1, VPAC2 , and PAC1 Receptor) in the Rat Brain. Journal of Comparative Neurology, 476, 388-413. http://dx.doi.org/10.1002/cne.20231</mixed-citation></ref><ref id="scirp.61173-ref78"><label>78</label><mixed-citation publication-type="other" xlink:type="simple">Cuha-Reis, D., Ribeiro, J.A. and Sebastiao, A.M. (2005) VIP Enhances Synaptic Transmission to Hippocampal CA1 Pyramidal Cells through Activation of both VPAC1 and VPAC2 Receptors. Brain Research, 1049, 52-60. 
http://dx.doi.org/10.1016/j.brainres.2005.04.077</mixed-citation></ref><ref id="scirp.61173-ref79"><label>79</label><mixed-citation publication-type="other" xlink:type="simple">Blechman, J. and Levkowitz, G. (2013) Alternative Splicing of the Pituitary Adenylate Cyclase-Activating Polypeptide Receptor PAC1: Mechanism of Fine Tuning of Brain Activity. Frontiers in Endocrinology, 4, 1-19. 
http://dx.doi.org/10.3389/fendo.2013.00055</mixed-citation></ref><ref id="scirp.61173-ref80"><label>80</label><mixed-citation publication-type="other" xlink:type="simple">Lang, B., Song, B., Davidson, W., MacKenzie, A., Smith, N., McCaig, C.D., Harmar, A.J. and Shen, S. (2006) Expression of the Human PAC1 Receptor Leads to Dose-Dependent Hydrocephalus-Related Abnormalities in Mice. Journal of Clinical Investigations, 116, 1924-1934. http://dx.doi.org/10.1172/JCI27597</mixed-citation></ref><ref id="scirp.61173-ref81"><label>81</label><mixed-citation publication-type="other" xlink:type="simple">Sun, Q.-Q., Prince, D.A. and Huguenard, J.R. (2003) Vasoactive Intestinal Peptide and Pituitary Adenylate Cyclase Activating Polypeptide Activate Hyperpolarization Activated Cation Current and Depolarize Thalamocortical Neurons in Vitro. Journal of Neuroscience, 23, 2751-2758.</mixed-citation></ref><ref id="scirp.61173-ref82"><label>82</label><mixed-citation publication-type="other" xlink:type="simple">Hoshino, M., Yanihara, C., Hong, Y.-M., Kishida, S., Katsumaru, Y., Vandermeers, A., Vandermeers-Piret, M.-C., Robberecht, P., Christophe, J. and Yanaihara, N. (1984) Primary Structure of Helodermin, a VIP-Secretin-Like Peptide Isolated from Gila Monster Venom. FEBS Letters, 178, 233-239. http://dx.doi.org/10.1016/0014-5793(84)80607-9</mixed-citation></ref><ref id="scirp.61173-ref83"><label>83</label><mixed-citation publication-type="other" xlink:type="simple">Robberecht, P., Waelbroeck, M., Camus, J.C., DeNeef, P., Coy, D.H. and Christophe, J. (1984) Effect of His1 Modifications on the Ability of Vasoactive Intestinal Peptide to Stimulate Adenylate Cyclase from Rat and Human Tissue. Peptides, 5, 529-535. http://dx.doi.org/10.1016/0196-9781(84)90110-4</mixed-citation></ref><ref id="scirp.61173-ref84"><label>84</label><mixed-citation publication-type="other" xlink:type="simple">Laburthe, M., Couvineau, A. and Tan, V. (2007) Class II G Protein-Coupled Receptors for VIP and PACAP Structure, Models of Activation and Pharmacology. Peptides, 28, 1631-1639. http://dx.doi.org/10.1016/j.peptides.2007.04.026</mixed-citation></ref><ref id="scirp.61173-ref85"><label>85</label><mixed-citation publication-type="other" xlink:type="simple">Hoare, S.R.J. (2005) Mechanisms of Peptide and Nonpeptide Ligand Binding to Class B G-Protein Coupled Receptors. Drug Discovery Today, 10, 417-427. http://dx.doi.org/10.1016/S1359-6446(05)03370-2</mixed-citation></ref><ref id="scirp.61173-ref86"><label>86</label><mixed-citation publication-type="other" xlink:type="simple">Dong, M., Pinon, D.I., Asmann, Y.W. and Miller, L.J. (2006) Possible Endogenous Agonist Mechanism for Activation of Secretin Family G-Protein-Coupled Receptors. Molecular Pharmacology, 70, 206-213. 
http://dx.doi.org/10.1124/mol.105.021840</mixed-citation></ref><ref id="scirp.61173-ref87"><label>87</label><mixed-citation publication-type="other" xlink:type="simple">terHaar, E., Koth, C.M., Abdul-Manan, N., Swenson, L., Coll, J.T., Lippke, J.A., Lepre, C.A., Garcia-Guzman, M. and Moore, J.M. (2010) Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class B GPCR, Reveals the Site of Drug Antagonism. Structure, 18, 1083-1093. http://dx.doi.org/10.1016/j.str.2010.05.014</mixed-citation></ref><ref id="scirp.61173-ref88"><label>88</label><mixed-citation publication-type="other" xlink:type="simple">Parthier, C., Reedtz-Runge, S., Rudolph, R. and Stubbs, M.T. (2009) Passing the Baton in Class B GPCRs: Peptide Hormone Activation via Helix Induction. Trends in Biochemical Sciences, 34, 303-310. 
http://dx.doi.org/10.1016/j.tibs.2009.02.004</mixed-citation></ref><ref id="scirp.61173-ref89"><label>89</label><mixed-citation publication-type="other" xlink:type="simple">Usdin, T.B., Bonner, T.I. and Mezey, E. (1994) Two Receptors for Vasoactive Intestinal Polypeptide with Similar Specificity and Complementary Distributions. Endocrinology, 135, 2662-2680. 
http://dx.doi.org/10.1210/endo.135.6.7988457</mixed-citation></ref><ref id="scirp.61173-ref90"><label>90</label><mixed-citation publication-type="other" xlink:type="simple">Harikrishnan, L.S., Srivastava, N., Kayser, L.E., Nirschl, D.S., Kumaragurubaran, K., Roy, A., Gupta, A., Karmakar, S., Karatt, T., Mathur, A., Burford, N.T., Chen, J., Kong, Y., Cvijic, M.E., Coope, C.B., Poss, M.A., Trainor, G.L. and Wong, T.W. (2012) Identification and Optimization of Small Molecule Antagonists of Vasoactive Intestinal Peptide Receptor-1 (VIPR1). Bioorganic and Medicinal Chemistry Letters, 22, 2287-2290. 
http://dx.doi.org/10.1016/j.bmcl.2012.01.082</mixed-citation></ref><ref id="scirp.61173-ref91"><label>91</label><mixed-citation publication-type="book" xlink:type="simple">Dockray, G.J. (1994) Vasoactive Intestinal Polypeptide and Related Peptides. In: Walsh, J.H. and Dockray, G.J., Eds., Gut Peptides, Raven Press Ltd., New York, 447-472.</mixed-citation></ref><ref id="scirp.61173-ref92"><label>92</label><mixed-citation publication-type="other" xlink:type="simple">Inagaki, N., Yoshida, H., Mizuta, M., Fujii, Y., Gonol, T., Mijazaki, J. and Seino, S. (1994) Cloning and Functional Characterization of a Third Pituitary Adenylate Cyclase Activating Polypeptide Receptor Subtype Expressed in Insulin Secreting Cells. Proceedings of the National Academy of Sciences, 91, 2679-2683. 
http://dx.doi.org/10.1073/pnas.91.7.2679</mixed-citation></ref><ref id="scirp.61173-ref93"><label>93</label><mixed-citation publication-type="other" xlink:type="simple">Sekiguchi, Y., Kasai, K., Hasegawa, K., Suzuki, Y. and Shimoda, S. (1994) Glycogenolytic Activity of Pituitary Adenylate Cyclase Activating Polypeptide (PACAP) in Vivo and in Vitro. Life Science, 55, 1219-1228. 
http://dx.doi.org/10.1016/0024-3205(94)00661-X</mixed-citation></ref><ref id="scirp.61173-ref94"><label>94</label><mixed-citation publication-type="other" xlink:type="simple">Yokota, C., Kawai, K., Ohashi, S., Watanabe, Y. and Yamashita, K. (1995) PACAP Stimulates Glucose Output from the Perfused Rat liver. Peptides, 16, 55-60. http://dx.doi.org/10.1016/0196-9781(94)00143-T</mixed-citation></ref><ref id="scirp.61173-ref95"><label>95</label><mixed-citation publication-type="other" xlink:type="simple">Wei, Y. and Mojsov, S. (1996) Multiple Human Receptors for Pituitary Adenylate Cyclase Activating Polypeptide and Vasoactive Intestinal Peptide Are Expressed in Tissue-Specific Manner. Annals of the New York Academy of Sciences, 805, 624-627. http://dx.doi.org/10.1111/j.1749-6632.1996.tb17531.x</mixed-citation></ref><ref id="scirp.61173-ref96"><label>96</label><mixed-citation publication-type="other" xlink:type="simple">Yu, R.J., Zhang, H.H., Huang, L., Liu, X.F. and Chen, J.S. (2011) Anti-Hyperglycemic, Antioxidant and Anti-Inflammatory Effects of VIP and a VPAC1 Agonist on Streptozotocin-Induced Diabetic Mice. Peptides, 32, 216-222. 
http://dx.doi.org/10.1016/j.peptides.2010.11.017</mixed-citation></ref><ref id="scirp.61173-ref97"><label>97</label><mixed-citation publication-type="other" xlink:type="simple">Ago, Y., Condro, M.C., Tan, Y.-V., Ghiani, C.A., Colwell, C.S., Cushman, J.D., Fanselow, M.S., Hashimoto, H. and Waschek, J.A. (2015) Reductions in Synaptic Proteins and Selective Alteration of Prepulse Inhibition in Male C57BL/6 Mice after Postnatal Administration of a VIP Receptor (VIPR2) Agonist. Psychopharmacology, 232, 2181-2189. http://dx.doi.org/10.1007/s00213-014-3848-z</mixed-citation></ref><ref id="scirp.61173-ref98"><label>98</label><mixed-citation publication-type="other" xlink:type="simple">Asnicar, M.A., Koster, A., Heiman, M.L., Tinsley, F., Smith, D.P., Galbreath, E., Fox, N., Ma, Y.L. and Blum, W.F. (2002) Vasoactive Intestinal Polypeptide/Pituitary Adenylate Cyclase-Activating Peptide Receptor 2 Deficiency in Mice Results in Growth Retardation and Increased Basal Metabolic Rate. Endocrinology, 143, 3994-4006. 
http://dx.doi.org/10.1210/en.2002-220354</mixed-citation></ref><ref id="scirp.61173-ref99"><label>99</label><mixed-citation publication-type="other" xlink:type="simple">Nicot, A., Otto, T., Brabet, P. and DiCicco-Bloom, M. (2004) Altered Social Behavior in Pituitary Adenylate Cyclase-Activating Type 1 Receptor-Deficient Mice. Journal of Neuroscience, 24, 8786-8795. 
http://dx.doi.org/10.1523/JNEUROSCI.1910-04.2004</mixed-citation></ref><ref id="scirp.61173-ref100"><label>100</label><mixed-citation publication-type="other" xlink:type="simple">Otto, C., Martin, M., Wolfer, D.P., Lipp, H.-P., Maldonado, R. and Schütz, G. (2001) Altered Emotional Behavior in PACAP-Type—I-Receptor-Deficient Mice. Molecular Brain Research, 92, 78-84. 
http://dx.doi.org/10.1016/S0169-328X(01)00153-X</mixed-citation></ref><ref id="scirp.61173-ref101"><label>101</label><mixed-citation publication-type="other" xlink:type="simple">Moreno, D., Gourlet, P., De Neef, P., Cnudde, J., Waelbroeck, M. and Robberecht, P. (2000) Development of Selective Agonists and Antagonists for the Human Vasoactive Intestinal Polypeptide VPAC2 Receptor. Peptides, 21, 1543-1549. 
http://dx.doi.org/10.1016/S0196-9781(00)00309-0</mixed-citation></ref><ref id="scirp.61173-ref102"><label>102</label><mixed-citation publication-type="other" xlink:type="simple">Gourlet, P., Vertongen, P., Vandermeers, A., Vandermeers-Piret, M.-C., Rathe, J., de Neef, P., Waelbroeck, M. and Robberecht P. (1997) The Long-Acting Vasoactive Intestinal Polypeptide Agonist Ro 25-1553 Is Highly Selective of the VIP2 Receptor Subclass. Peptides, 18, 403-408. http://dx.doi.org/10.1016/S0196-9781(96)00322-1</mixed-citation></ref><ref id="scirp.61173-ref103"><label>103</label><mixed-citation publication-type="other" xlink:type="simple">Ceraudo, E., Tan, Y.-V., Nicole, P., Couvineau, A. and Laburthe, M. (2008) The N-Terminal Parts of VIP and Antagonist PG97-269 Physically Interact with Different Regions of the Human VPAC1 Receptor. Journal of Molecular Neurosciences, 36, 245-248. http://dx.doi.org/10.1007/s12031-008-9073-7</mixed-citation></ref><ref id="scirp.61173-ref104"><label>104</label><mixed-citation publication-type="other" xlink:type="simple">Boni, L.J., Ploug, K.B., Jansen-Olensen, J. and Gupta, S. (2009) The in Vivo Effect of VIP, PACAP-38 and PACAP-27 and mRNA Expression of Their Receptors in Rat Middle Meningeal Artery. Cephalagia, 29, 837-847. 
http://dx.doi.org/10.1111/j.1468-2982.2008.01807.x</mixed-citation></ref><ref id="scirp.61173-ref105"><label>105</label><mixed-citation publication-type="other" xlink:type="simple">Dickson, L., Aramori, I., McCulloch, J., Sharkey, J. and Finlayson, K. (2006) A Systematic Comparison of Intracellular Cyclic AMP and Calcium Signaling Highlights Complexities in Human VPAC/PAC Receptor Pharmacology. Neuropharmacology, 51, 1086-1098. http://dx.doi.org/10.1016/j.neuropharm.2006.07.017</mixed-citation></ref><ref id="scirp.61173-ref106"><label>106</label><mixed-citation publication-type="other" xlink:type="simple">Pan, C.Q., Li, F., Tom, I., Wang, W., Dumas, M., Froland, W., Yung, S.L., Li, Y., Roczniak, S., Claus, T.H., Wang, C.Y. and Whelan, J.P. (2007) Engineering Novel VPAC2-Selective Agonists with Improved Stability and Glucose-Lowering Activity in Vivo. Journal of Pharmacology and Experimental Therapeutics, 320, 900-906. 
http://dx.doi.org/10.1124/jpet.106.112276</mixed-citation></ref><ref id="scirp.61173-ref107"><label>107</label><mixed-citation publication-type="other" xlink:type="simple">Xia, M., Sreedharan, S.P., Bolin, D.R., Gaufo, G.O. and Goetzl, E.J. (1997) Novel Cyclic Peptide Agonist of High Potency and Selectivity for the Type II Vasoactive Intestinal Peptide Receptor. Journal of Pharmacology and Experimental Therapeutics, 281, 629-633.</mixed-citation></ref><ref id="scirp.61173-ref108"><label>108</label><mixed-citation publication-type="other" xlink:type="simple">Vertongen, P., Schiffmann, S.N., Gourlet, P. and Robberecht, P. (1997) Autoradiographic Visualization of the Receptor Subclasses for Vasoactive Intestinal Polypeptide. Peptides, 18, 1547-1554. 
http://dx.doi.org/10.1016/S0196-9781(97)00229-5</mixed-citation></ref><ref id="scirp.61173-ref109"><label>109</label><mixed-citation publication-type="other" xlink:type="simple">Uchida, D., Tatsuno, I., Tanaka, T., Hirai, A., Saito, Y., Moro, O. and Tajima, M. (1998) Maxadilan Is a Specific Agonist and Its Deleted Peptide (M65) Is a Specific Antagonist for PACAP Type 1 Receptor. Annals of the New York Academy of Sciences, 865, 253-258. http://dx.doi.org/10.1111/j.1749-6632.1998.tb11185.x</mixed-citation></ref><ref id="scirp.61173-ref110"><label>110</label><mixed-citation publication-type="other" xlink:type="simple">Lerner, E.A., Iuga, A.O. and Reddy, V.B. (2007) Maxadilan, a PAC1 Agonist from Sand Flies. Peptides, 28, 1651-1654. http://dx.doi.org/10.1016/j.peptides.2007.06.021</mixed-citation></ref><ref id="scirp.61173-ref111"><label>111</label><mixed-citation publication-type="other" xlink:type="simple">Lerner, E.A. and Shoemaker, C.B. (1992) Maxadilan: Cloning and Functional Expression of the Gene Encoding This Potent Vasodilator Peptide. Journal of Biological Chemistry, 267, 1062-1066.</mixed-citation></ref><ref id="scirp.61173-ref112"><label>112</label><mixed-citation publication-type="other" xlink:type="simple">Hadwen, J., MacKenzie, D., Shamim, F., Mongeon, K., Holcik, M., MacKenzie, A. and Faroq, F. (2014) VPAC2 Receptor Agonist BAY 55-9837 Increases SMN Protein Levels and Moderates Disease Phenotype in Severe Spinal Muscular Atrophy Mouse Models. Orphanet Journal of Rare Diseases, 9, 4. http://www.ojrd.com/content/9/1/4</mixed-citation></ref><ref id="scirp.61173-ref113"><label>113</label><mixed-citation publication-type="other" xlink:type="simple">Sugarman, E.A., Nagan, N., Zhu, H., Akmaev, V.R., Zhou, Z., Rohlfs, E.M., Flynn, K., Hendrickson, B.C., Scholl, T., Sirko-Osada, D.A. and Allitto, B.A. (2012) Pan-Ethnic Carrier Screening and Prenatal Diagnosis for Spinal Muscular Atrophy: Clinical Laboratory Analysis of &gt;72400 Specimens. European Journal of Genetics, 20, 27-32. 
http://dx.doi.org/10.1038/ejhg.2011.134</mixed-citation></ref><ref id="scirp.61173-ref114"><label>114</label><mixed-citation publication-type="other" xlink:type="simple">Lindén, A., Hansson, L., Andersson, A., Palmqvist, M., Arvidsson, P., Lofdahl, C.-G. and Larsson, P. (2003) Bronchodilation by an Inhaled VPAC2 Receptor Agonist in Patients with Stable Asthma. Thorax, 58, 217-221. 
http://dx.doi.org/10.1136/thorax.58.3.217</mixed-citation></ref><ref id="scirp.61173-ref115"><label>115</label><mixed-citation publication-type="other" xlink:type="simple">Moro, O. and Lerner, E.A. (1997) Maxadilan, the Vasodilator from Sand Flies, Is a Specific Pituitary Adenylate Cyclase Activating Peptide Type I Receptor Agonist. Journal of Biological Chemistry, 272, 966-970. 
http://dx.doi.org/10.1074/jbc.272.2.966</mixed-citation></ref><ref id="scirp.61173-ref116"><label>116</label><mixed-citation publication-type="other" xlink:type="simple">Svensjo, E., Saraiva, E.M., Bozza, M.T., Oliveira, S.M.P., Lerner, E.A. and Scharfstein, J. (2009) Salivary Gland Homogenates of Lutzomyia longipalpis and Its Vasodilatory Peptide Maxadilan Cause Plasma Leakage via PAC1 Receptor Activation. Journal of Vascular Research, 46, 435-446. http://dx.doi.org/10.1159/000197866</mixed-citation></ref><ref id="scirp.61173-ref117"><label>117</label><mixed-citation publication-type="other" xlink:type="simple">Hoare, S.R.J. (2007) Allosteric Modulators of Class B G Protein-Coupled Receptors. Current Neuropharmacology, 5, 168-179. http://dx.doi.org/10.2174/157015907781695928</mixed-citation></ref><ref id="scirp.61173-ref118"><label>118</label><mixed-citation publication-type="other" xlink:type="simple">Pissarek, M. (2014) Neuropeptide Receptors in Pain Circuitries: Useful Targets for CNS Imaging with Non-Peptide Ligands Suitable for PET? World Journal of Neuroscience, 4, 353-383. http://dx.doi.org/10.4236/wjns.2014.44040</mixed-citation></ref><ref id="scirp.61173-ref119"><label>119</label><mixed-citation publication-type="other" xlink:type="simple">Dong, M., Pinon, D.I. and Miller, L.J. (2008) Exploration of the Endogenous Agonist Mechanism for Activation of Secretin and VPAC1 Receptors Using Synthetic Glycosylated Peptides. Journal of Molecular Neuroscience, 36, 254-259. http://dx.doi.org/10.1007/s12031-008-9058-6</mixed-citation></ref><ref id="scirp.61173-ref120"><label>120</label><mixed-citation publication-type="other" xlink:type="simple">Robl, J.A. (1990) A New and Versatile Route for the Synthesis of Highly Substituted Benzenoids. Tetrahedron Letters, 31, 3421-3424. http://dx.doi.org/10.1016/S0040-4039(00)97412-4</mixed-citation></ref><ref id="scirp.61173-ref121"><label>121</label><mixed-citation publication-type="other" xlink:type="simple">Madsen, P., Ling, A., Plewe, M., Sams, C.K., Knudsen, L.B., Sidelmann, U.G., Ynddal, L., Brand, C.L., Andersen, B., Murphy, D., Teng, M., Truesdale, L., Kiel, D., May, J., Kuki, A., Shi, S.H., Johnson, M.D., Teston, K., Feng, J., Lakis, J., Anderes, K., Gregor, V. and Lau, J. (2002) Optimization of Alkylidene Hydrazide Based Human Glucagon Receptor Antagonists. Discovery of the Highly Potent and Orally Available 3-Cyano-4-Hydroxybenzoic Acid [1-(2,3,5,6-teramethylbenzyl)-1H-indol-4-ylmethylene] Hydrazide. Journal of Medicinal Chemistry, 45, 5755-5775. 
http://dx.doi.org/10.1021/jm0208572</mixed-citation></ref><ref id="scirp.61173-ref122"><label>122</label><mixed-citation publication-type="other" xlink:type="simple">Yu, R., Guo, X., Zhong, J., Li, M., Zeng, Z. and Zhang, H. (2012) The N-Terminal HSDCIF Is Required for Cell Surface Trafficking and Dimerization of Family B G Protein Coupled Receptor PAC1. PLoS ONE, 7, e51811.</mixed-citation></ref><ref id="scirp.61173-ref123"><label>123</label><mixed-citation publication-type="other" xlink:type="simple">Jagoda, E.M., Lang, L., McCullough, K., Contoreggi, C., Moon, K.B., Ma, Y., Rice, K.C., Szajek, L.P., Eckelman, W.C. and Kiesewetter, D.O. (2011) [76Br]BMK-152, a Nonpeptide Analogue, with High Affinity and Low Nonspecific Binding for the Corticotrophin-Releasing Factor Type 1 Receptor. Synapse, 65, 910-918. 
http://dx.doi.org/10.1002/syn.20919</mixed-citation></ref><ref id="scirp.61173-ref124"><label>124</label><mixed-citation publication-type="other" xlink:type="simple">Zuev, D., Mattson, R.J., Huang, H., Mattson, G.K., Zueva, L., Nielsen, M., Kozlowski, E.S., Huang, X.S., Dedong, W., Gao, Q., Lodge, N.J., Bronson, J.J. and Macor, J.E. (2011) Potential CRF1R PET Imaging Agents: N-Flu-oroalkyl-8-(6-methoxy-2-methyl-pyridin-3-yl)-2,7-dime-thyl-N-alkylpyrazolo[1,5-a][1,3,5]triazin-4-amines. Bioorganic &amp; Medicinal Chemistry Letters, 21, 2484-2488. http://dx.doi.org/10.1016/j.bmcl.2011.02.050</mixed-citation></ref><ref id="scirp.61173-ref125"><label>125</label><mixed-citation publication-type="other" xlink:type="simple">Chugunov, A.O., Simms, J., Poyner, D.R., Dehouck, Y., Rooman, M., Gilis, D. and Langer, I. (2010) Evidence That Interaction between Conserved Residues in Transmembrane Helices 2,3 and 7 Are Crucial for Human VPAC 1 Receptor Activation. Molecular Pharmacology, 78, 394-401. http://dx.doi.org/10.1124/mol.110.063578</mixed-citation></ref><ref id="scirp.61173-ref126"><label>126</label><mixed-citation publication-type="other" xlink:type="simple">Langer, I. (2012) Conformational Switches in the VPAC1 Receptor. British Journal of Pharmacology, 166, 79-84. 
http://dx.doi.org/10.1111/j.1476-5381.2011.01616.x</mixed-citation></ref><ref id="scirp.61173-ref127"><label>127</label><mixed-citation publication-type="other" xlink:type="simple">Dong, M., Xu, X., Ball, A.M., Makhoul, J.A., Lam, P.C.H., Pinon, D.I., Orry, A., Sexton, P.M., Abagyan, R. and Miller, L.J. (2012) Mapping Spatial Approximations between the Amino Terminus of Secretin and Each of the Extracellular Loops of Its Receptor Using Cysteine Trapping. FASEB Journal, 26, 5092-5105. 
http://dx.doi.org/10.1096/fj.12-212399</mixed-citation></ref><ref id="scirp.61173-ref128"><label>128</label><mixed-citation publication-type="other" xlink:type="simple">Katritch, V., Cherezov, V. and Stevens, R.C. (2012) Diversity and Modularity of G Protein-Coupled Receptor Structures. Trends in Pharmacological Sciences, 33, 17-26. http://dx.doi.org/10.1016/j.tips.2011.09.003</mixed-citation></ref><ref id="scirp.61173-ref129"><label>129</label><mixed-citation publication-type="other" xlink:type="simple">Unal, H. and Karnik, S.S. (2012) Domain Coupling in GPCRs: The Engine for Induced Conformational Changes. Trends in Pharmacological Sciences, 33, 79-88. http://dx.doi.org/10.1016/j.tips.2011.09.007</mixed-citation></ref><ref id="scirp.61173-ref130"><label>130</label><mixed-citation publication-type="other" xlink:type="simple">Avlani, V.A., Gregory, K.J., Morton, C.J., Parker, M.W., Sexton, P.M. and Christopoulos, A. (2007) Critical Role for the Second Extracellular Loop in the Binding of Both Orthosteric and Allosteric G Protein-Coupled Receptor Ligands. Journal of Biological Chemistry, 282, 25677-25686. http://dx.doi.org/10.1074/jbc.M702311200</mixed-citation></ref><ref id="scirp.61173-ref131"><label>131</label><mixed-citation publication-type="other" xlink:type="simple">Solano, R.M., Langer, I., Perret, J., Vertongen, P., Juarranz, M.G., Robberecht, P. and Waelbroeck, M. (2001) Two Basic Residues of the H-VPAC1 Receptor Second Transmembrane Helix Are Essential for Ligand Binding and Signal Transduction. Journal of Biological Chemistry, 276, 1084-1088. http://dx.doi.org/10.1074/jbc.M007686200</mixed-citation></ref><ref id="scirp.61173-ref132"><label>132</label><mixed-citation publication-type="other" xlink:type="simple">Donelly, D. (2012) The Structure and Function of the Glucagon-Like Peptide-1 Receptor and Its Ligands. British Journal of Pharmacology, 166, 27-41. http://dx.doi.org/10.1111/j.1476-5381.2011.01687.x</mixed-citation></ref><ref id="scirp.61173-ref133"><label>133</label><mixed-citation publication-type="other" xlink:type="simple">Lagerstrom, M.C. and Schioth, H.B. (2008) Structural Diversity of G Protein-Coupled Receptors and Significance for Drug Discovery. Nature Reviews, 7, 339-357. http://dx.doi.org/10.1038/nrd2518 http://dx.doi.org/10.1038/nrd2592</mixed-citation></ref><ref id="scirp.61173-ref134"><label>134</label><mixed-citation publication-type="book" xlink:type="simple">Mustafa, T. and Eiden, L.E. (2006) Secretin Superfamily: PACAP, VIP and Related Neuropeptides In: Lajtha, A. and Lim, R., Eds., Handbook of Neurochemistry and Neurobiology: Neuroactive Proteins and Peptides, 3rd Edition, Springer-Verlag, Berlin, 476.</mixed-citation></ref></ref-list></back></article>